KEGG   Rhodococcus equi: REQ_17450Help
Entry
REQ_17450         CDS       T01352                                 

Gene name
thrC
Definition
threonine synthase thrc
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    REQ_17450 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REQ_17450 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    REQ_17450 (thrC)
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     REQ_17450 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1845464..1846567
Genome map
AA seq 367 aa AA seqDB search
MTGANSKAETKSTPVHTPWPGLIEAYRDRLAIGPNWKTVTLREGGTPLLPAGHLSELTGC
DVYLKVEGLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAAKAKMGCAV
LVPQGKIAMGKLAQAVMHGARIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQ
KTAAFEICDALGKAPDIHALPVGNAGNITAYWRGYSEYFADGITSVRPRMLGVQAAGAAP
LVHGAPVKDPETIATAIRIGAPASWNGAVAAKEESNGAFRAATDEAILEAYRLIAATEGV
FVEPASAASVAGLLAAHKEGWLDAGQTVVCTVTGNGLKDPDTALAGMPAVQPIPVDPVAV
AAALELA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgccaactccaaggccgaaaccaagtcgacccccgtccacaccccgtggccg
ggactgatcgaggcctaccgcgaccggctcgcgatcggaccgaactggaagacggtcacg
ctgcgcgagggtggtacgccgctgctgcccgccgggcacctgtcggagctgaccggttgc
gacgtctacctcaaggtcgagggcctcaaccccaccgggtcgttcaaggaccgcggtatg
acgatggccgtcaccgacgcgctcgcccgcggccagcaggccgtgctgtgtgcctccacc
ggcaacacctccgcctcggccgccgcatacgccgccaaggcgaagatgggctgcgcggtg
ctggtgccgcagggcaagatcgcgatgggcaagctcgcccaggccgtcatgcacggcgca
cgcatcatccaggtgcagggcaacttcgacgactgcctcgagctggcccgcaagaccacc
gccgaattcccgaccatcggtctggtcaactccgtcaacccggtccgcatcgagggtcag
aagaccgccgcgttcgagatctgtgacgctctgggcaaggcgcccgacatccacgcgctg
cccgtcggtaacgccggcaacatcaccgcctactggcgtggctactccgagtacttcgcc
gacggcatcacctcggtgcgcccgcgcatgctcggtgtccaggctgcaggtgccgcgccg
ctcgtgcacggcgccccggtcaaggacccggagaccatcgccaccgctatccgcatcggc
gcaccggcctcgtggaacggtgccgtcgccgccaaggaagagtcgaacggtgccttccgt
gccgcgaccgacgaggcgatcctcgaggcgtaccggttgatcgccgcgaccgagggcgtc
ttcgtcgagcccgcgtcggccgcgagcgtcgcaggactcctcgccgcccacaaggaaggt
tggctggatgccggtcagacggtcgtctgcaccgtgaccggcaacggcctcaaggatccc
gacaccgccctcgcgggcatgccggcggtccagccgatcccggtcgacccggtcgccgtc
gccgcggcgctcgagctggcatag

DBGET integrated database retrieval system