KEGG   Rhodococcus equi: REQ_17450Help
Entry
REQ_17450         CDS       T01352                                 

Gene name
thrC
Definition
threonine synthase thrc
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:req01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:req00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:req00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1845464..1846567
Genome map
AA seq 367 aa AA seqDB search
MTGANSKAETKSTPVHTPWPGLIEAYRDRLAIGPNWKTVTLREGGTPLLPAGHLSELTGC
DVYLKVEGLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAAKAKMGCAV
LVPQGKIAMGKLAQAVMHGARIIQVQGNFDDCLELARKTTAEFPTIGLVNSVNPVRIEGQ
KTAAFEICDALGKAPDIHALPVGNAGNITAYWRGYSEYFADGITSVRPRMLGVQAAGAAP
LVHGAPVKDPETIATAIRIGAPASWNGAVAAKEESNGAFRAATDEAILEAYRLIAATEGV
FVEPASAASVAGLLAAHKEGWLDAGQTVVCTVTGNGLKDPDTALAGMPAVQPIPVDPVAV
AAALELA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgccaactccaaggccgaaaccaagtcgacccccgtccacaccccgtggccg
ggactgatcgaggcctaccgcgaccggctcgcgatcggaccgaactggaagacggtcacg
ctgcgcgagggtggtacgccgctgctgcccgccgggcacctgtcggagctgaccggttgc
gacgtctacctcaaggtcgagggcctcaaccccaccgggtcgttcaaggaccgcggtatg
acgatggccgtcaccgacgcgctcgcccgcggccagcaggccgtgctgtgtgcctccacc
ggcaacacctccgcctcggccgccgcatacgccgccaaggcgaagatgggctgcgcggtg
ctggtgccgcagggcaagatcgcgatgggcaagctcgcccaggccgtcatgcacggcgca
cgcatcatccaggtgcagggcaacttcgacgactgcctcgagctggcccgcaagaccacc
gccgaattcccgaccatcggtctggtcaactccgtcaacccggtccgcatcgagggtcag
aagaccgccgcgttcgagatctgtgacgctctgggcaaggcgcccgacatccacgcgctg
cccgtcggtaacgccggcaacatcaccgcctactggcgtggctactccgagtacttcgcc
gacggcatcacctcggtgcgcccgcgcatgctcggtgtccaggctgcaggtgccgcgccg
ctcgtgcacggcgccccggtcaaggacccggagaccatcgccaccgctatccgcatcggc
gcaccggcctcgtggaacggtgccgtcgccgccaaggaagagtcgaacggtgccttccgt
gccgcgaccgacgaggcgatcctcgaggcgtaccggttgatcgccgcgaccgagggcgtc
ttcgtcgagcccgcgtcggccgcgagcgtcgcaggactcctcgccgcccacaaggaaggt
tggctggatgccggtcagacggtcgtctgcaccgtgaccggcaacggcctcaaggatccc
gacaccgccctcgcgggcatgccggcggtccagccgatcccggtcgacccggtcgccgtc
gccgcggcgctcgagctggcatag

DBGET integrated database retrieval system