KEGG   Rhodococcus equi: REQ_17650Help
Entry
REQ_17650         CDS       T01352                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase mura
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
req  Rhodococcus equi
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    REQ_17650 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    REQ_17650 (murA)
Enzymes [BR:req01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     REQ_17650 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1864076..1865347
Genome map
AA seq 423 aa AA seqDB search
MSERFLVAGGNRLVGEVSVGGAKNSVLKLMAAALLAEGTTVIENCPDILDVPLMADVLRG
LGCDVSLEGDVARITTPAQPKYHADFAAVRQFRASVCVLGPLVARCHKAVVALPGGDAIG
SRPLDMHQSGLRLLGAHSEIEHGCVVAEADDLYGANIRLAFPSVGATENILMAAVLARGE
TIIDNAAREPEIVDLCNMLNRMGAKVSGAGSTTLTIRGVDRLQPTSHRVIGDRIVAATWG
IAAAMTRGDVLVRGVNPKHLSLVLDKLRAAGSQITTEADGFRVVQTGRPQAVNFATLPYP
GFPTDLQPMAIGLAAIADGTSMITENVFEARFRFVEEMIRLGADARTDGHHAVIRGVEEL
SSAPVWSSDIRAGAGLVLAGLVADGVTEVHDVYHIDRGYPRFVEDLVGLGGDIRRVSDEG
DGQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaacgctttcttgtcgctggtgggaaccgactcgtcggtgaggtgtcggtgggc
ggcgcgaagaacagcgtcctgaaactgatggccgcagctctgctcgccgagggcacgacc
gtcatcgagaactgtcctgacatcctcgacgtgccgctgatggccgatgtactgcgcgga
ctgggctgcgacgtgtcgctcgagggggacgtcgcgaggattacgacaccggcgcagccg
aagtaccacgcggacttcgcggccgtccggcagttccgagcgtcggtgtgtgtcctcggt
ccgctggtcgcgcgatgccacaaggcagtcgtggcgcttcccggtggagacgcgatcggt
tcgcgccccctcgacatgcaccagtcaggacttcgcctgctgggtgcgcacagcgagatc
gagcacggctgcgtcgtcgcggaggccgacgacctgtacggggccaacatccgcctggcg
ttcccgtcggtgggggcgaccgagaacattctcatggctgccgtactggccaggggagag
acgatcatcgacaacgcggcgcgcgagccggagatcgtggacctgtgcaacatgctgaac
cggatgggtgcgaaggtctccggcgccggctcgacgacgctgaccattcgcggcgtcgac
cgcttgcagcccacgtcgcaccgggtcatcggcgaccggatcgtcgcggccacctggggt
atcgctgcagcgatgacgcggggggacgtgctcgtccgcggcgtgaacccgaagcacctc
agtctcgtgctcgacaagttgcgcgccgccggttcgcagatcaccaccgaggccgatggt
ttccgagtggtgcagaccggtcgtccgcaggccgtgaacttcgcgaccctcccgtaccca
ggattcccgacagacctgcagccgatggcgatcgggctcgcggcgatcgcggacggcacg
tcgatgatcaccgagaacgtcttcgaggcgcgattccggttcgtggaagagatgatccgc
ctgggtgcggatgcacgcaccgacgggcaccatgccgtcatccggggagtggaggagctg
tcgagcgccccggtgtggtcctcggacatccgtgccggcgccggcctggtgcttgcgggg
ctcgtcgcggacggggtgacagaagtgcacgacgtctaccacatcgatcgcggctacccc
cgattcgtcgaggacctggtcggattgggcggggacatccgtcgagtctcggacgaagga
gacgggcaatga

DBGET integrated database retrieval system