KEGG   Rhodococcus equi: REQ_17830Help
Entry
REQ_17830         CDS       T01352                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
req  Rhodococcus equi
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    REQ_17830
Enzymes [BR:req01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     REQ_17830
    3.5.1.-  
     REQ_17830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1895334..1895921)
Genome map
AA seq 195 aa AA seqDB search
MTGTALVVTDVQNDFCEGGALAVAGGAAVAAAIEELYSDHGYSAIVATRDNHIDPGDHFS
ETPDFVDSWPPHCVAGTPGAEFHPALGTGAIEETFSKGERSAAYSGFEGVSPSGESLADW
LRRHDIDAVDVVGIATDHCVRATALDSATEGFRTRVLLPFTAGVSPATVEAALAELDAAG
VELVGRLSEPGDAAP
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcacggcactcgtcgtcaccgacgtccagaacgacttctgcgagggcggtgca
ctcgccgtcgcgggcggtgcggcagtggccgccgcgatcgaggagctgtactccgaccac
ggctacagcgcgatcgtcgccacccgcgacaaccacatcgaccccggcgaccacttctcc
gagaccccggacttcgtcgacagctggccgccgcactgcgtggccgggacgccgggcgcc
gagttccatccggcactcgggaccggtgcgatcgaggagaccttctcgaagggcgagcgc
agcgccgcgtactcgggcttcgagggtgtctcgccgtccggcgagtcgctcgccgactgg
ttgcgccggcacgacatcgacgccgtcgatgtcgtcgggatcgcgaccgatcactgcgtc
cgggcgacggcgctggactccgccaccgagggcttccgcacccgcgtcctgctccccttt
accgcgggcgtgtcccccgccaccgtcgaggcggcattggccgagctcgacgcggccggc
gtcgagctggtcggccgcctctccgagccgggagacgccgcgccctga

DBGET integrated database retrieval system