KEGG   Rhodococcus equi: REQ_18730Help
Entry
REQ_18730         CDS       T01352                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
req  Rhodococcus equi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    REQ_18730
Enzymes [BR:req01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     REQ_18730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976839..1978740
Genome map
AA seq 633 aa AA seqDB search
MRHSHQPAGFPFSAIVGQDRLRLALILCAVHPGIGGVLVRGEKGTAKSTVVRALTALLPE
VGEGRRARLVELPVGATEDRVVGSIDLEKVLRDGERAFQPGLLADAHQGVLYVDEVNLLH
DHLVDVLLDAAAMGRVHVERDGVSHSHPAEFVLVGTMNPEEGELRPQLLDRFGLAVDVAA
SRDVEVRMQVVRRRLDYERDPVGFAARYAEQDADLARRIADARAVVDAVELSDAELRRIA
SVCASFDVEGMRADLVLARTATAHAAWRGADAVTEEDVRIAAELTLPHRRRRDPFDEPGL
DPQQLDDAMEQADADARAQEEPEPDPDGTGGGASPSEPEASTHDSKSRAGEQGSPESGSG
AGSERKAGAPGPQFRARLLEIPGVGDGAPGRRSRSRSTRGRAVRTTTEPGTGVHLVGTLF
AAAEHQTVRGRTAGAMRLAPSDIRGAVREGREGNLVLFVVDASGSMAARDRLSAVTGAVV
SLLRDAYQRRDKVAVITVRGTDAELVLPPTSSVDVAVRRLRAMRTGGRTPLAAGFLKARQ
VVLREQVRDPRRRALVVALTDGRATGAKDAVARARRAAGMLADTNVASIVVDCETGMVRL
GLAADLARDLRGGYVRLAELSAQQVAGVVRAAA
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccacagtcaccaacctgccgggtttccgttcagcgccatcgtcgggcaggaccgg
ctgcggctggcgctgatcctgtgcgccgtccacccgggcatcggcggcgtgctggtgcgg
ggcgagaagggcaccgccaaatccaccgtcgtacgtgcactgaccgccttgctgcccgag
gtgggcgaggggcgccgggcccggctcgtggaactgccggtcggcgcgaccgaggaccgt
gtcgtcggctcgatcgacctcgagaaggtactccgggacggcgaacgtgcgttccagccc
gggctgctcgccgacgcccatcagggcgtgctctacgtcgacgaggtcaaccttctccac
gatcacctggtggacgtgctgctcgacgccgcggccatgggtcgtgtccacgtcgaacgc
gacggcgtctcgcactcccacccggccgagttcgtcctggtcgggaccatgaatcccgag
gagggtgagctgcgcccgcagctgctggaccggttcggtctcgccgtcgacgtcgccgcc
tcacgggacgtggaggtgcgcatgcaggtggtccgccgccgtctcgactacgagcgcgac
cccgtcggcttcgccgcccggtatgccgagcaggacgccgacctggcccggcggatcgcc
gacgcccgtgccgtggtcgacgctgtcgagctatccgacgccgaactgcgtcgcatcgcg
tcggtgtgtgcgtcgttcgacgtcgagggcatgcgcgccgacctggtgctcgcgcgcacc
gcaaccgcgcacgccgcgtggcgcggggccgacgccgtcaccgaggaggacgtgcggatc
gccgccgaactgactctgccgcaccgccgtcggcgcgacccgttcgacgagccgggtctg
gacccgcagcagctcgacgacgcgatggagcaggccgacgccgacgcgcgtgcgcaggaa
gagcccgaacccgatcccgacgggaccggtggcggcgcatcgccgtcggagccggaagcg
tccacgcatgactcgaaatctcgagcaggcgaacagggatcgccggaatccggaagcggc
gcagggtcggaacgcaaggccggcgcgcccggcccgcagttccgggcgcgactgctcgag
attccgggggtgggcgacggggctccgggccggcggtcccgctcgcgttcgacccgtggc
cgcgccgtgcggacgaccaccgaaccgggaacgggcgtgcacctcgtgggcaccctgttc
gccgcggccgaacaccagaccgtgcgagggcgcaccgctggcgcgatgcggctggccccc
agcgatattcgcggcgccgtccgggaaggccgcgagggcaacctggtgctgttcgtggtc
gacgcgtccggttccatggcggcccgggatcggctgtccgccgtcaccggtgccgtcgtg
tcgctgctgcgcgacgcctatcagcgtcgggacaaggtcgcggtgatcaccgtccgcggc
acggatgccgagctggtgctgccgccgacgtcgtcggtggacgtcgccgtccgacgcctg
cgcgcgatgagaaccggcggtcgcacgccgctcgcggcgggtttcctgaaagcgcgtcag
gtcgtcctgcgcgagcaggtccgcgatccgcgtcgccgcgctctggtcgtcgccctcacg
gacggacgcgcgaccggggcgaaggacgccgtcgcgcgggcccggcgggccgccggaatg
ctggccgacaccaacgtcgcatcgatcgtcgtcgactgtgagaccggcatggtccgcctc
ggcttggcggccgacctcgcgcgcgatctgcggggcggttacgtccgcctcgcggaactg
tccgcgcagcaggtcgcgggcgtcgtccgcgctgccgcctga

DBGET integrated database retrieval system