KEGG   Rhodococcus equi: REQ_19940Help
Entry
REQ_19940         CDS       T01352                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
req  Rhodococcus equi
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    REQ_19940
Enzymes [BR:req01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     REQ_19940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103081..2104022
Genome map
AA seq 313 aa AA seqDB search
MSDRASPSVSPEVVVVGSVNVDTVIRVPRLPAPGETVLGIGAAEHVGGKGSNQAVAAARL
GRRVGLVGAVGDDADGRAVREALGAEGIDLVGLGERSGARTGAAVVQVDDSGENCITVLA
GANGDLDAAAVRTAADDLRRALVTVVQLEIPDAAVAEAIALAGGTVVLNPSPARPVAADV
LGRVDVLIVNRSELALLAGEAEPATSVQAARMAGRLSGPAAVVVTLGSDGAVLVRGGAVT
EVPAVPVERVVDPTGAGDTFTGALADALVRGEALDDAVRWAVEAAAIAVTAAGAQSAMPT
REQVLAARAGSRS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaccgtgcgtcaccgtcggtgtcgccggaagtcgtcgtcgtggggtccgtcaac
gtcgacaccgtcatccgggtcccgcggttgcctgcgcccggtgaaacggtgttggggatc
ggcgccgccgagcacgtcggcgggaagggttcgaatcaggcggtggccgccgcgcgcctc
ggtcgacgcgtggggctcgtgggcgcggtcggcgacgacgccgacgggcgcgcggtgcga
gaagcgttgggggccgagggcatcgacctggtggggctcggcgaacgatcgggtgcccgg
accggcgccgccgtcgtccaggtggacgactccggcgagaactgcatcacggtgctcgcc
ggcgccaacggtgatctcgacgccgccgcggtgcggacggccgccgacgacctgcggcgg
gcgctggtgaccgtggtccaactcgagatccccgacgccgccgtcgcggaagcaatcgcg
ctcgcgggtggcaccgtcgtcctcaacccgtcgcccgcgcgaccggtcgcagccgacgtg
ctcggccgtgtcgacgtcctcatcgtcaaccgctcggaactggcgttgctcgcgggggag
gccgaaccggcgacgtcggtgcaggccgcgcggatggcgggccggctctccggaccagcg
gccgtcgtggtcaccctcggctccgacggcgcggtgctggtgcggggcggcgcggtcacc
gaggtaccggcggttcccgtcgagcgggtcgtcgatccgaccggggccggtgacacgttc
accggtgctctcgcggatgcgctggtgcgcggcgaggcgctcgacgacgctgtgcgctgg
gcggtggaggccgccgcgatcgccgtcacggcggcgggggcgcagtcggcgatgcccacc
cgcgaacaggttctcgcggcgcgagcggggagccggtcgtga

DBGET integrated database retrieval system