KEGG   Rhodococcus equi: REQ_20600Help
Entry
REQ_20600         CDS       T01352                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
req  Rhodococcus equi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    REQ_20600 (hemG)
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     REQ_20600 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2172766..2174130
Genome map
AA seq 454 aa AA seqDB search
MTGGRVSVAVVGGGVTGLVAAYRLRQQLGPDAEITVLEAGSRLGGKLRTESLGDGPVDVG
AEAFIARRPEVTELIVELGIEDQLVHPAGRQPLIWSEGALHPLPTRTLMGIPSTAQSVAG
LVDADTVARIAAEPTMPFDWDRSADVDVASLVASRFGEQVVRRSVDPLLGGVYSGLADSI
GVRAALPALAAALDAGATSLTAAVAAALPTPSPGPVFGTLRDGYGTLLDALRDAARPHTV
LDASVTGLRRDGDGWWLDPVGHVDGVVLALPAPDMVRLVGASAPALAEAARGIELASSAV
VALALPDDTGVPENSGILVATGESLGAKAFTLSSRKWPHLAEREVTLVRASYGRFGDAAV
VDSSDEQLVTMARADLETVTGVSTEPVDAVVARWHSGLPQLAPGHLDRVAAIETAAADID
GVEVAGAYLYGVGVPACVASATTAATRLAARVAG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggagggcgagtctcggttgcggtcgtcggtggcggcgtcaccggtctcgtcgct
gcctaccggttgcggcagcaactcggccccgacgccgagatcaccgttctggaggcggga
tcacggctcggcggcaagctgcgaacagagtctctcggtgacggccccgtcgacgtcggc
gcggaagcgttcatcgcccgccggcccgaggtgaccgagctgatcgtcgagctcggcatc
gaggaccagctggtccatcccgcgggtcgccagccgctgatctggtcggagggtgcgttg
catccgctgcccacccgcacgctcatgggcatcccgtcgaccgcgcagtccgtcgccggg
ctcgtcgatgccgacaccgtcgcgcgcatcgcggccgagccgacgatgccgttcgattgg
gatcggtccgccgacgtcgatgtcgcgtcgctcgtcgcgagccggttcggtgagcaggtg
gtgcgtcggtccgtggacccgctgctcggtggggtctactcgggactggccgactcgatc
ggtgttcgggccgcgcttccggccctcgccgcggcgctcgacgccggggcgacgagcctc
acggccgccgtggcggctgctctgccgacaccgtcgccaggcccggtgttcgggaccctg
cgcgacggctacggcaccctgctcgacgcgctgcgcgacgcggcccggccgcacaccgtc
ctcgacgcgtccgtgaccggcctgcgccgggacggcgacggctggtggctcgaccccgtc
ggccacgtggacggtgtggtgctcgcgctgcccgcacccgacatggttcgtctcgtcggc
gcctcggcgcccgcgctcgccgaggcggcgcgcggtatcgagctcgcatcgtccgcggtc
gtcgcgctggcgctgccggacgacaccggggtccccgagaactccggaatcctggtcgcg
acgggggagtcgttgggcgccaaggccttcaccctgtcgagccgcaaatggccgcacctg
gccgagcgggaggtcacgctggtgcgcgcgtcgtacggcaggttcggggacgccgccgtc
gtcgacagcagcgacgagcagctcgtcacgatggcccgcgccgacctcgagacggtgaca
ggggtctcgaccgaaccggtggatgcggtcgtcgcccgctggcacagcgggctgccgcag
ctcgcgcccgggcacctggaccgggtcgccgcgatcgagaccgccgcggccgacatcgac
ggagtcgaggtcgcgggcgcctacctgtacggggtcggggttccggcgtgcgtcgcgtcg
gcgacgacggccgcgacacggctcgcggcacgagtggcaggatga

DBGET integrated database retrieval system