KEGG   Rhodococcus equi: REQ_20870Help
Entry
REQ_20870         CDS       T01352                                 

Gene name
ruvA
Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
req  Rhodococcus equi
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:req03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2201878..2202483
Genome map
AA seq 201 aa AA seqDB search
MIASVRGEVLEVGLDHAVIEAAGVGYRVNATPATLATLRRGDESRLLTAMIVREDSMTLY
GFADAESRDLFGLLQTVSGVGPRLAMAILAVLEPEALRKALAEGNVTALTRVPGIGKRGA
ERMVVELRDKVEAVAVTGDLPGAGAATSASVVRDQVVEALTGLGFKLEHAEKATDTVVAA
DPEAPTSTVLRSALALLGKTR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcttcggttcggggtgaggttctcgaggtcgggctggaccatgcggtgatcgag
gccgcgggcgtcgggtaccgcgtcaacgcgacacccgccaccctggcgacccttcggcgg
ggcgacgaatcgcgcctgttgacggcgatgatcgtccgtgaggactcgatgacgctgtac
ggcttcgccgacgcggagtcgcgagatctgttcggcctgctgcagacggtgtccggggtg
gggccgcggctggcgatggcgatactcgcggtcctcgaacccgaggcgctccgcaaggcc
ctcgcagagggcaatgtcaccgcgctcactcgtgttccgggcatcggcaagcgcggcgcc
gagcgcatggtcgtcgagcttcgcgacaaggtcgaggccgtcgccgtgaccggtgatctg
ccgggcgcgggtgcggccacgtccgcgagcgtcgtccgtgaccaggtggtcgaggcgctg
accggtctcggcttcaagctcgagcacgcggagaaggccaccgacaccgtggtggcggcc
gatccggaggctccgacgtccacagtcctgcggtcggcactcgcgctgctcgggaagaca
cgatga

DBGET integrated database retrieval system