KEGG   Rhodococcus equi: REQ_21890Help
Entry
REQ_21890         CDS       T01352                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
req  Rhodococcus equi
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    REQ_21890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_21890
  Lipid metabolism
   00071 Fatty acid degradation
    REQ_21890
  Amino acid metabolism
   00350 Tyrosine metabolism
    REQ_21890
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    REQ_21890
   00626 Naphthalene degradation
    REQ_21890
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     REQ_21890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2311999..2313015
Genome map
AA seq 338 aa AA seqDB search
MPATTMRAWRTTRPGPLTDRPLELGRELLPRPTSRDLLVKVLACGVCRTDLHVVAGELPP
HRLNVVPGHEVIGEVVAVGDDAGGRFSVGQRVGVAWLRGTCGHCRYCVRGDENLCPYSTY
TGWDADGGYAEYTTVPVDYALELPTGYPVVELAPLLCAGIIGYRALLRADLPEGGRLGIY
GFGGSAHLTAQVALARGARVHVMTRGEEARELAFSLGAASVQGAAEPPPEPLDSAILFAP
AGDLVPPALEALDAGGTLALAGIHLSDIPPLNYQRDLFRERQLRSVTANTRDDARDFLAF
AQRHRLRVSAHRYPLDAADKALADLAGGVFGGAAVLVP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaccaccatgcgggcctggcgcacgacgagacccggcccgctcaccgaccgt
ccgctcgagctcgggcgcgagttgcttccgcgtccgacgagcagggacctgctggtgaag
gtgctggcgtgtggtgtctgccgcaccgacctccacgtggtcgcgggagagttgccgccg
caccggctcaacgtggtgccgggccacgaggtgatcggcgaggtcgtcgccgtcggtgac
gacgcgggtggccgcttctcggtggggcagcgggtgggcgtggcgtggctgcggggcacg
tgcgggcactgccggtactgcgtgcgcggcgacgagaacctgtgcccctattcgacgtac
accggctgggacgcggacggcggctacgccgagtacacgacggtgccggtcgactacgcg
ctcgaactgcccaccggctatcccgtcgtcgagctggcacccctgctctgcgcgggcatc
atcggttatcgcgcgttgctgcgggcggatctacccgagggcggtcggctggggatctac
ggcttcgggggcagtgcgcacctgaccgcgcaggtcgcgctcgcccggggagcgcgcgtg
cacgtgatgacgcggggcgaggaggcccgtgaactggcgttcagtctcggcgcggcttcc
gtgcagggtgccgcggagccgcccccggaaccgttggactcggcgatcctgttcgcgcct
gccggtgacctggtcccgccggcgctggaggcgctcgacgcgggtgggacgctcgcgctc
gcgggcatccacctcagcgacatcccgccgttgaactaccagcgagacctgttccgggag
cggcaactgcggagcgtgacggcgaacacgcgggacgatgcccgcgacttcctggccttc
gcgcaacggcaccgactgcgggtcagcgcgcaccgctacccgttggatgccgcggacaag
gcgctcgccgatctcgcgggcggcgtgttcggcggcgccgccgttctcgtgccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system