KEGG   Rhodococcus equi: REQ_22030Help
Entry
REQ_22030         CDS       T01352                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase tpi
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
req  Rhodococcus equi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_22030 (tpi)
   01230 Biosynthesis of amino acids
    REQ_22030 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_22030 (tpi)
   00051 Fructose and mannose metabolism
    REQ_22030 (tpi)
   00562 Inositol phosphate metabolism
    REQ_22030 (tpi)
Enzymes [BR:req01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     REQ_22030 (tpi)
Exosome [BR:req04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   REQ_22030 (tpi)
  Exosomal proteins of bladder cancer cells
   REQ_22030 (tpi)
  Exosomal proteins of melanoma cells
   REQ_22030 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2327624..2328409
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFSLPAKYFEKVDVTVLPPFTDIRTVQTLVEGD
KLLLTYGAQDVSAHESGAYTGEISGSMLAKLGCTFVVVGHSERRTLHGESDETVLAKTKA
ALRYGITPIVCIGEGLNIREAGEHVSFNVAQLKASLAGLSPDEISKIVVAYEPVWAIGTG
KVASAADAQEVCKAVRDTLAELASAEIAQAVRVLYGGSVNAKNVGELIAQPDIDGGLVGG
ASLKADEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaagcctttgatcgccggcaactggaagatgaacctcaaccatctcgaggcc
atcgctctggtgcagaagatcgctttctcgttgcccgcgaagtacttcgagaaggtcgac
gtgaccgtgctcccgccgttcaccgacatccgcaccgtgcagacgctggtcgagggcgac
aagctcctgctcacctacggtgcccaggacgtctccgcccacgagtcgggtgcgtacacc
ggcgagatcagcggctcgatgctggccaagctgggctgcacgttcgtggtcgtcggccac
tccgagcggcgcacgctgcacggcgagtccgacgagaccgtcctcgccaagaccaaggcc
gcgctgcgatacgggatcaccccgatcgtctgcatcggtgagggcctgaacatccgcgag
gccggcgagcacgtgtcgttcaacgttgcgcagctgaaggcttcgctggcgggtctgtcg
cccgacgagatctcgaagatcgtcgtcgcgtacgaacccgtctgggccatcggcaccggc
aaggtggcctcggctgccgacgcgcaggaagtctgcaaggcggtgcgtgacacgctcgcc
gagctggcgtcagcggagatcgcccaggccgtgcgggtcctctacggcggttcggtcaac
gccaagaacgtcggcgagctcatcgctcagcccgacatcgacggtggcctcgtcggcggg
gcctcgctcaaggcggacgagttcgcgaccctgtcggccatcgcggccggcggaccgctc
ccgtga

DBGET integrated database retrieval system