KEGG   Rhodococcus equi: REQ_24360Help
Entry
REQ_24360         CDS       T01352                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
req  Rhodococcus equi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_24360
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    REQ_24360
   00630 Glyoxylate and dicarboxylate metabolism
    REQ_24360
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     REQ_24360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2593464..2595647
Genome map
AA seq 727 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNDEALPGTGVSAEAFWEGAGKVFADLAPKNKALLAKRDDL
QAQIDAWHRERAGKPLDGAEYKAFLQEIGYLLPEPEPFQVATENVDAEIATTAGPQLVVP
VLNARFALNASNARWGSLYDALYGTDAISEDGGAEKGKGYNKVRGDKVIAWARNFLDTAA
PLAKGSHTEATRYFVVDGKLAVELGGEVVTTLAEPEKFVGYLGDGDHPTSVLLRNNGLHV
EIEIDPTSPIGKTDGAGVKDVVLESAITTIMDFEDSVAAVDADDKVVGYRNWLGLNRGDL
SESFDKGGKTVTRTLNGDRTYTTPDGEELTLHGRSLLFVRNVGHLMTNPAILDADGNELP
EGILDALITSACAIHGLSIDDDHGPLNNSRTGSIYIVKPKQHGPEEVAFTTELFGRVEEV
LGLPANTLKVGIMDEERRTTVNLAACIKEADQRVVFINTGFLDRTGDEIHTSMEAGTMVR
KADMKKQTWIAAYEDWNVDTGLATGLQGKAQIGKGMWAMTDLMADMLEQKIGHPRSGANT
AWVPSPTGATLHATHYHQVDVFAVQDQLKGKPRATVDEILTIPLAPSTDWSDAEKQQELD
NNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVTEADVV
ASLERMAPVVDRQNEGDASYRPMAPDFDSNIAFQAAKELILEGGKQPSGYTEPILHRRRR
EYKAANA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgtgcaggtcggtggtcttcaggtcgccaaggttctctacgacttcgtg
aacgatgaggctcttccgggcaccggcgtttccgccgaggcgttctgggagggtgcgggc
aaggtgttcgccgacctggcccccaagaacaaggcactgctcgccaagcgcgacgacctg
caggcgcagatcgacgcgtggcatcgcgagcgggcgggcaagccgctcgatggcgccgag
tacaaggcgttcctgcaggagatcggctacctgctgcccgagcccgagccgttccaggtc
gcgaccgagaacgtcgacgccgagatcgccacgaccgccggcccgcagctcgtcgtcccg
gtcctcaatgcccgcttcgcgctgaacgcgtccaacgcccgctggggttcgctgtacgac
gcgctctacggcaccgacgcgatctccgaggacggtggcgcggagaagggtaagggctac
aacaaggttcgcggcgacaaggtcatcgcgtgggcccgcaatttcctggacacggcagca
cccctggcgaagggctcgcacaccgaggccacccgctacttcgtggtcgacggcaagctg
gccgtcgaactgggcggcgaggtcgtgacgactctggccgagccggagaagttcgtcggc
tacctcggcgacggtgaccaccccacctcggtgctgctgcgcaacaacggcctgcacgtc
gagatcgagatcgacccgacgtccccgatcggcaagaccgacggtgccggcgtcaaggac
gtcgtgctcgagtcggcgatcaccacgatcatggacttcgaggactcggtggccgcggtc
gacgccgacgacaaggtcgtcggctaccggaactggctggggctcaaccgcggcgacctg
tcggagtcgttcgacaagggcggcaagaccgtcacccgcacgctcaacggcgaccgcacc
tacaccacgccggacggtgaggagctgaccctgcacgggcgctcgctgctgttcgtccgc
aacgtcggacacctgatgacgaaccccgcgatcctcgacgccgacggcaacgaactgccc
gagggcatcctcgacgcgctgatcaccagcgcgtgcgcgatccacggcctgagcatcgac
gacgaccacggcccgctgaacaactcgcgcaccggctcgatctacatcgtcaagcccaag
cagcacggccccgaggaggtggccttcaccaccgagctgttcggccgcgtcgaagaggtc
ctgggtctgccggcgaacaccctcaaggtcggcatcatggacgaggagcggcgcaccacc
gtcaacctcgcggcctgcatcaaggaagcggaccagcgggtggtgttcatcaacaccggc
ttcctcgaccgcaccggagacgagatccacacctcgatggaggccggcacgatggtgcgc
aaggccgacatgaagaagcagacgtggatcgccgcgtacgaggactggaacgtcgacacc
ggcctcgcgaccggtctgcagggcaaggctcagatcggtaagggcatgtgggccatgacc
gatctgatggccgacatgctcgagcagaagatcggtcacccccgctccggcgccaacacc
gcgtgggtgccgtcgccgaccggcgcgacactgcacgccacgcactaccaccaggtggac
gtgttcgcggtccaggaccagctgaagggcaagccccgcgcgacggtcgacgagatcctc
acgatcccgctcgccccgtccaccgactggtccgacgccgagaagcagcaggaactcgac
aacaactgccagtcgatcctcggctacgtggtgcgctggatcgacgccggcgtcggctgc
tccaaggtgcccgacatccacgacgtcgcactcatggaggaccgggcgacgctgcgcatc
tcgagccagctgctggccaactggctgcggcacggcatcgtcaccgaggccgacgtcgtc
gcgagcctcgagcggatggcgccggtcgtcgaccgccagaacgagggcgacgcgtcgtac
cgtccgatggccccggacttcgactccaacatcgccttccaggcggccaaggaactgatc
ctcgagggcggcaagcagcccagcggctacaccgagccgatcctgcaccgccgtcgtcgc
gagtacaaggccgccaacgcctga

DBGET integrated database retrieval system