KEGG   Rhodococcus equi: REQ_24360Help
Entry
REQ_24360         CDS       T01352                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
req  Rhodococcus equi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_24360
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    REQ_24360
   00630 Glyoxylate and dicarboxylate metabolism
    REQ_24360
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     REQ_24360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2593464..2595647
Genome map
AA seq 727 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNDEALPGTGVSAEAFWEGAGKVFADLAPKNKALLAKRDDL
QAQIDAWHRERAGKPLDGAEYKAFLQEIGYLLPEPEPFQVATENVDAEIATTAGPQLVVP
VLNARFALNASNARWGSLYDALYGTDAISEDGGAEKGKGYNKVRGDKVIAWARNFLDTAA
PLAKGSHTEATRYFVVDGKLAVELGGEVVTTLAEPEKFVGYLGDGDHPTSVLLRNNGLHV
EIEIDPTSPIGKTDGAGVKDVVLESAITTIMDFEDSVAAVDADDKVVGYRNWLGLNRGDL
SESFDKGGKTVTRTLNGDRTYTTPDGEELTLHGRSLLFVRNVGHLMTNPAILDADGNELP
EGILDALITSACAIHGLSIDDDHGPLNNSRTGSIYIVKPKQHGPEEVAFTTELFGRVEEV
LGLPANTLKVGIMDEERRTTVNLAACIKEADQRVVFINTGFLDRTGDEIHTSMEAGTMVR
KADMKKQTWIAAYEDWNVDTGLATGLQGKAQIGKGMWAMTDLMADMLEQKIGHPRSGANT
AWVPSPTGATLHATHYHQVDVFAVQDQLKGKPRATVDEILTIPLAPSTDWSDAEKQQELD
NNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGIVTEADVV
ASLERMAPVVDRQNEGDASYRPMAPDFDSNIAFQAAKELILEGGKQPSGYTEPILHRRRR
EYKAANA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgtgcaggtcggtggtcttcaggtcgccaaggttctctacgacttcgtg
aacgatgaggctcttccgggcaccggcgtttccgccgaggcgttctgggagggtgcgggc
aaggtgttcgccgacctggcccccaagaacaaggcactgctcgccaagcgcgacgacctg
caggcgcagatcgacgcgtggcatcgcgagcgggcgggcaagccgctcgatggcgccgag
tacaaggcgttcctgcaggagatcggctacctgctgcccgagcccgagccgttccaggtc
gcgaccgagaacgtcgacgccgagatcgccacgaccgccggcccgcagctcgtcgtcccg
gtcctcaatgcccgcttcgcgctgaacgcgtccaacgcccgctggggttcgctgtacgac
gcgctctacggcaccgacgcgatctccgaggacggtggcgcggagaagggtaagggctac
aacaaggttcgcggcgacaaggtcatcgcgtgggcccgcaatttcctggacacggcagca
cccctggcgaagggctcgcacaccgaggccacccgctacttcgtggtcgacggcaagctg
gccgtcgaactgggcggcgaggtcgtgacgactctggccgagccggagaagttcgtcggc
tacctcggcgacggtgaccaccccacctcggtgctgctgcgcaacaacggcctgcacgtc
gagatcgagatcgacccgacgtccccgatcggcaagaccgacggtgccggcgtcaaggac
gtcgtgctcgagtcggcgatcaccacgatcatggacttcgaggactcggtggccgcggtc
gacgccgacgacaaggtcgtcggctaccggaactggctggggctcaaccgcggcgacctg
tcggagtcgttcgacaagggcggcaagaccgtcacccgcacgctcaacggcgaccgcacc
tacaccacgccggacggtgaggagctgaccctgcacgggcgctcgctgctgttcgtccgc
aacgtcggacacctgatgacgaaccccgcgatcctcgacgccgacggcaacgaactgccc
gagggcatcctcgacgcgctgatcaccagcgcgtgcgcgatccacggcctgagcatcgac
gacgaccacggcccgctgaacaactcgcgcaccggctcgatctacatcgtcaagcccaag
cagcacggccccgaggaggtggccttcaccaccgagctgttcggccgcgtcgaagaggtc
ctgggtctgccggcgaacaccctcaaggtcggcatcatggacgaggagcggcgcaccacc
gtcaacctcgcggcctgcatcaaggaagcggaccagcgggtggtgttcatcaacaccggc
ttcctcgaccgcaccggagacgagatccacacctcgatggaggccggcacgatggtgcgc
aaggccgacatgaagaagcagacgtggatcgccgcgtacgaggactggaacgtcgacacc
ggcctcgcgaccggtctgcagggcaaggctcagatcggtaagggcatgtgggccatgacc
gatctgatggccgacatgctcgagcagaagatcggtcacccccgctccggcgccaacacc
gcgtgggtgccgtcgccgaccggcgcgacactgcacgccacgcactaccaccaggtggac
gtgttcgcggtccaggaccagctgaagggcaagccccgcgcgacggtcgacgagatcctc
acgatcccgctcgccccgtccaccgactggtccgacgccgagaagcagcaggaactcgac
aacaactgccagtcgatcctcggctacgtggtgcgctggatcgacgccggcgtcggctgc
tccaaggtgcccgacatccacgacgtcgcactcatggaggaccgggcgacgctgcgcatc
tcgagccagctgctggccaactggctgcggcacggcatcgtcaccgaggccgacgtcgtc
gcgagcctcgagcggatggcgccggtcgtcgaccgccagaacgagggcgacgcgtcgtac
cgtccgatggccccggacttcgactccaacatcgccttccaggcggccaaggaactgatc
ctcgagggcggcaagcagcccagcggctacaccgagccgatcctgcaccgccgtcgtcgc
gagtacaaggccgccaacgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system