KEGG   Rhodococcus equi: REQ_25370Help
Entry
REQ_25370         CDS       T01352                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    REQ_25370 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REQ_25370 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REQ_25370 (trpA)
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     REQ_25370 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2712715..2713518)
Genome map
AA seq 267 aa AA seqDB search
MSQRDSRLAPTFAKCRDENRAALVGYLPAGYPDVPTSIDVFKTMVDAGCDIIEVGIAYSD
PVMDGPTIQTAAETALRSGVRVRDVFTVVEQIASVGGKAVVMTYWNPVLQYGVDRFARDL
AAAGGLGLITPNLIPEEADEWMVASEEHHLDRIFLVAPSSTEERLAMTLEASSGFIYAAS
TMGVTGARDAVSSMAPELTARIRAHSDIPVGVGLGVRSGAQAAEIASYADAVIVGSAIVS
AAEQGLDAVRALTAELAEGVRSANVAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaacgagattcgcgcctggcgcccacgttcgcgaagtgccgcgacgagaatcgg
gccgcgctcgtcgggtatctgcccgccggatacccggacgttcccacgtcgatcgacgtg
ttcaagacgatggtcgacgcgggctgcgacatcatcgaggtcggtatcgcctactccgat
ccggtgatggacggaccgaccatccagaccgccgccgagaccgcgctgcgcagcggcgtc
cgggtgcgcgacgtgttcaccgtcgtcgaacagatcgcgtcggtcggtggcaaggccgtc
gtcatgacgtactggaacccggtgctccagtacggcgtcgatcgcttcgcccgtgatctc
gccgccgccggcggcctcggcctgatcacgccgaacctcatccccgaggaagccgacgag
tggatggtggcgtccgaggaacatcacctggaccgcatcttcctggtcgcaccgtcgtcg
accgaggagcgtctggcgatgaccctcgaggcgagcagcgggttcatctacgccgcgtcg
acgatgggcgtgaccggcgcccgggacgcagtgtcctcgatggcccccgaactgaccgcc
cggatccgcgcgcattcggacatcccggtcggcgtcggcctcggcgttcgttccggggcg
caggcggcggagatcgcgtcgtacgcggatgccgtcatcgtcgggtcggcgatcgtctcg
gcggccgagcagggattggacgcggtgcgggcgctcactgccgaactcgcggagggtgtg
cgctcggctaacgtggcgtcgtga

DBGET integrated database retrieval system