KEGG   Rhodococcus equi: REQ_25380Help
Entry
REQ_25380         CDS       T01352                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    REQ_25380 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REQ_25380 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REQ_25380 (trpB)
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     REQ_25380 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2713515..2714822)
Genome map
AA seq 435 aa AA seqDB search
MSSRNEALVSKGGDLPPASAGLTERSGHEPDPGGHWGVYGGRHVPEALMAVIEEVTAEYE
KARADDNFLDELDRLQRDYTGRPSPIFEATRLREHAGGARILLKREDLNHTGSHKINNVL
GQVLLAKRMGKTRIIAETGAGQHGVATATACALLGLECIVYMGAVDTARQALNVARMRLL
GAEVVSVESGSATLKDAINEALRDWVTNADRTYYCFGTAAGPHPFPMIVRDFQRVVGLEA
RAQVQASTGRLPDAVVACVGGGSNAIGIFHAFIGDPTVKLVGYEAAGDGVETGRHAATFA
GGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDTGRASYEPITDSEA
MDALLLLSRTEGIIPAIESAHAVAGALKLGRELGEGAIIVVSLSGRGDKDMDTAAKWFGL
FDDSADDSTEEGSAK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcacgcaatgaggccctcgtgtccaagggtggcgatctgcctcccgccagcgcc
ggtctgacggagcggtccggccatgaaccggaccctggtggccactggggggtctacggc
ggtaggcacgtacccgaggcgctcatggcggtgatcgaggaggtcaccgcggagtacgag
aaggctcgcgcggacgacaacttcctcgacgaactcgaccggctgcagcgcgactacacc
ggccgtccgtccccgatcttcgaagcgacccggctgcgtgagcacgccggcggcgcgcgc
atcctgctcaagcgggaagacctgaaccacaccggatctcacaagatcaacaacgtgctg
gggcaggtgctgctcgccaagcgcatgggcaagacccgcatcatcgccgagaccggagcc
ggccagcacggcgtcgcgacggcgaccgcgtgtgccctgctcgggctcgagtgcatcgtc
tacatgggtgcggtcgacaccgcccggcaggccctcaacgtcgcccggatgcgtctgctc
ggcgccgaggtcgtctccgtcgaatcgggttcggccactttgaaggacgcgatcaacgag
gcgctgcgcgactgggtcaccaacgcagaccgcacgtactactgtttcggcaccgcggcc
ggcccgcacccgttcccgatgatcgtgcgcgacttccagcgcgtcgtgggtctcgaggcg
cgtgcacaggtgcaggcgtcgaccgggcgcctccccgacgcggtcgtcgcgtgtgtgggc
ggtggctcgaacgccatcggcatcttccacgcgttcatcggcgacccgacggtcaagctc
gtcggctacgaggccgccggcgacggcgtcgagaccggtcggcatgcagcgacattcgcc
ggtggcaccccgggcgctttccagggtgcgtactcgtacctgctgcaggacgaggacggc
cagaccatcgagtcgcactcgatctccgcgggcctggactacccgggtgtcggccccgag
cacgcctacctcaaggacaccggtcgcgcgtcgtacgagccgatcaccgactccgaggcg
atggacgcactgctgctgctctcgcgtacggagggcatcatcccggcgatcgagtcggcc
cacgccgtcgcgggcgccctcaagctcggccgcgagctgggggagggcgcgatcatcgtc
gtgagcctgtccggccgtggcgacaaggacatggacaccgcagcgaagtggttcgggctg
ttcgacgactctgctgatgattcgaccgaggaaggttcggccaagtga

DBGET integrated database retrieval system