KEGG   Rhodococcus hoagii: REQ_25390Help
Entry
REQ_25390         CDS       T01352                                 

Gene name
trpC
Definition
(GenBank) phosphoribosylanthranilate isomerase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
req  Rhodococcus hoagii
Pathway
req00400  Phenylalanine, tyrosine and tryptophan biosynthesis
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01130  Biosynthesis of antibiotics
req01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REQ_25390 (trpC)
Enzymes [BR:req01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     REQ_25390 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBH48575
UniProt: E4WI19
Position
complement(2714884..2715693)
Genome map
AA seq 269 aa AA seqDB search
MTVLDSILDGVRADVAAREAVLDLSAVKAAAAAAPPALDAAAALRAPGIGVIAEVKRASP
SKGALADIPDPAVLAAAYEAGGARMISVLTEERRFHGSLADLDAVRKAVNIPVLRKDFIV
GPYQIHEARAHGADVILLIVAALEQHVLASLLDRTESLGMTALVEVHTEEEADRALEAGA
SVIGINARNLKTLEVDMDTFGRIAPGLPTDLVKIAESGVRGTADLLAYAGAGADAVLVGE
GLVTSGDPRAAVSDLVTAGAHPSCPKPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttctcgactcgattctcgacggagtgcgcgccgacgtcgccgcccgtgaagcc
gttctcgacctctctgccgtgaaggccgcggccgctgccgcccctccggcgctcgacgcg
gccgccgctctgcgcgcgcccggaatcggcgtcatcgccgaggtgaagcgggcgagcccg
tcgaagggcgccctcgccgacatcccggaccccgcggtgctggcagcggcatacgaggcc
ggcggggcgcggatgatcagcgtgctcaccgaggagcggcgtttccacggctcgctcgcc
gatctcgacgctgtccgcaaggccgtgaacattccggtcctgcgcaaggacttcatcgtc
gggccgtaccagatccacgaggcgcgcgcgcacggcgcggacgtgatcctgctgatcgtc
gccgcgctcgagcagcacgttctcgcgtctctgctggaccgtaccgagtcgctggggatg
accgcgctcgtcgaggtccacaccgaggaagaggccgaccgcgcgctcgaggccggcgcc
agcgtcatcggcatcaacgcccgcaacctcaagacgctcgaggtcgacatggacacgttc
gggcgcatcgccccgggcctgccgacggacctcgtgaagatcgccgagtccggcgttcgt
ggtaccgcggacctgctggcgtacgccggtgccggtgccgacgcggtcctggtcggggag
gggttggtcaccagcggcgatccgcgtgccgccgtgtcggatctcgtgacggcgggtgcg
catccgtcgtgccccaagccgtcgcgctga

DBGET integrated database retrieval system