KEGG   Rhodococcus equi: REQ_26450Help
Entry
REQ_26450         CDS       T01352                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-l-alanyl-d-glutamate-2,6-diaminopimela te ligase mure
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
req  Rhodococcus equi
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:req00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:req00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2798064..2799569)
Genome map
AA seq 501 aa AA seqDB search
MDLEDLWTPVSPRTLREVVDRLCEAGHVVADAPVDDRRVITGVCQDSRRVRPGDLYAALP
GRRHHGADFASEASARGAVAMLSDRPSDIVPTVVVDDPRVALGPLAAWAYGNPSTAFDLY
GVTGTNGKTSTVYLLEAALVAAGLRTGVVTGVTVRGPGTARPATRTTPEACELQQSFVEF
VEEGVDAVAMEVSSHGLAEHRIDGSRFDVGVFTNLARDHLDYHPDMEAYYTAKARLFGRD
LCERAAVCIDDDYGRRLAGEVAVPHLTFSARDPGADVYATTVRAQRWGSTFTLHHRGERV
PVRLRVLGGHQVDNAVAALAALSVRGIDLGAAVAGIEALDAIPGRLERVDVGQPFLALVD
YVHNTAGQHRLFPYLRSVTPGRIVVVLGATGERDPGKRAPLGFTAARYAEVVVVTDESAF
SDDAADLRDAVAAGARRAGTAEVVVIPDRGEAIAVAVDLAGAGDTVLLAGRGHDPALVDD
GVATAFDDRAALRNALLTRAY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgaggacctgtggacgccggtttctccccgcacgttgcgtgaggtcgtcgac
cgcctgtgcgaggcgggtcacgtggttgccgacgcccccgtggacgaccggcgggtgatc
accggagtgtgtcaggactcccggcgtgtccgcccgggtgacctctacgctgcactgccg
ggacgtcggcatcacggtgcggatttcgcctcggaggcatccgcgcgcggcgctgtcgcg
atgctgagcgaccggccgtcggacatcgtgccgacggtcgtcgtcgacgatccacgtgtg
gcactgggaccgctcgcggcatgggcgtacggcaatccgtcgaccgccttcgacctgtac
ggcgtgacagggacgaacggcaagaccagcaccgtctacctgctcgaggccgctctcgtg
gcggcgggtctccggacgggggtggtcaccggtgtcacggtgcggggacccggcacggcc
cggcccgcgacgcggaccacgccggaagcgtgtgagctgcagcagagcttcgtcgagttc
gtcgaggagggagtggacgcggtcgcgatggaggtgtcgagccacggactggccgaacac
cggatcgacggatcccgtttcgacgtcggagtcttcaccaacctcgcgcgtgaccacctc
gactaccaccccgacatggaggcctactacacagcgaaggcacgtctgttcggacgtgac
ctctgcgaacgcgcggccgtctgcatcgacgacgactacggccgccggctcgcgggcgag
gtcgcggttccacacctgacgttctcggcacgcgatcccggtgccgacgtgtacgcgacg
acggtgcgggcacaacggtgggggagcacgttcactctgcaccaccggggcgaacgggta
ccggttcggttgcgggtcctcggcgggcaccaggtggacaatgctgtcgcggccctcgcg
gcgctgtccgtccgaggaatcgacctcggcgctgccgtggccggtatcgaggcactcgac
gcgatccccgggcggctcgagcgtgtggacgtcgggcaaccgttcctcgcgttggtcgac
tacgtgcacaacaccgccggtcagcatcggctgttcccctatctgcgttcggtgacgccc
gggcggatcgtggttgtgctgggcgccaccggcgagcgtgatcccggcaagcgcgctccg
ctcggattcaccgcggcgcgatacgcggaggtggtcgtcgtgacggacgagagcgccttc
tccgacgacgccgccgatctccgcgacgccgttgcggcgggagcgcgccgggccgggacg
gcagaggtggtggtgatcccggatcgcggggaggcgatcgcggtagccgtggacctggcc
ggtgccggggacaccgtgctcctcgcgggacgcgggcacgacccggcactcgtcgacgac
ggcgtggcgaccgcgttcgacgatcgggccgcgctgcgcaacgccctgctgacgcgggcc
tactag

DBGET integrated database retrieval system