KEGG   Rhodococcus hoagii: REQ_26790Help
Entry
REQ_26790         CDS       T01352                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
req  Rhodococcus hoagii
Pathway
req00340  Histidine metabolism
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01230  Biosynthesis of amino acids
Module
req_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    REQ_26790 (hisD)
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     REQ_26790 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBH48704
UniProt: E4WIE7
Position
complement(2827199..2828521)
Genome map
AA seq 440 aa AA seqDB search
MLARTDLRGRTPSTAELRGALPRGGVDVDAVLHQVRPVVEDIRDRGAEAALEYGEKFDGV
RPGTVRVPQAELDRALAELDADVRAALEVAIERTRKVHADQRRTDTVTEVVPGGTVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVESLVVASPPQAAFGGLPHPTILAAAAL
LGVDEVWAVGGAQAVALLTYGGTDTDSAELAPVDLITGPGNIFVTAAKRLCRGLVGIDAE
AGPTEIAILADHTADPVHVAADMISQAEHDVMAASVLVTTSTDLADAVDTALAAQLEITK
HRERVETALRGSQSGTVLVDDIAAGLKVVNAYAAEHLEIQTENASAVAAQVRSAGAIFVG
PWAPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVDYSEAALKDVAGHVITLA
NAEDLPAHGEAVRLRFEALQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcaccgaccttcgtggtcgtaccccttccaccgctgagctccggggcgcg
ttgccccgtggcggagtggacgtggacgcggtgctgcatcaggtccgccccgtcgtcgag
gacatccgcgatcgcggcgccgaggccgcgctcgagtacggcgagaagttcgacggtgtc
cgccccggtaccgtgcgcgtcccgcaggccgagctggaccgtgcgctcgccgaactcgac
gccgacgtccgcgccgccctcgaggtggcgatcgaacggacccgcaaggtccacgccgac
cagcgccgcaccgacaccgtgaccgaggtggtccccggcgggaccgtcaccgagcgctgg
gttccggtcgagcgcgtcggtctgtacgtgccgggcggcaacgcggtgtacccgtcgtcg
gtcgtgatgaacgtcgtgccggcgcaggccgcgggagtcgagtcgctggtcgtggcgtcg
ccgccgcaggctgcgttcggtggcctgccgcacccgacgatcctggcggcggccgcgcta
ctcggcgtcgacgaggtgtgggccgtcggcggcgcgcaggccgtcgcgctgctcacctac
ggcggtaccgacaccgacagcgctgaactcgcgccggtcgatctcatcaccggacccggc
aacatcttcgtcaccgccgccaagcggctgtgccgtggactggtcggcatcgacgccgag
gccggccccaccgagatcgcgattctcgccgatcacaccgcggaccccgtgcacgtggcg
gccgacatgatcagccaggccgagcacgacgtcatggctgcgagcgtgctggtgaccacg
tcgaccgacctggccgacgccgtcgacaccgcgttggccgcgcagctcgagatcaccaag
caccgcgagcgtgtcgagaccgcgctgcgcggcagccagtcgggcaccgtgctggtggac
gacatcgcggccggtctgaaggtcgtgaacgcctacgccgccgagcacctcgagatccag
accgagaacgcgtccgcggtggcggcgcaggtgcgctccgccggagcgatcttcgtcggt
ccgtgggctccggtgagcctcggcgactactgcgccggctccaatcacgtgctgcccacc
gcgggctgcgcgcggcactcgtcgggtctgagcgtgcagacgttcctgcgtggcatccac
gtggtcgactactccgaggcggccttgaaggacgttgccgggcacgtcatcacgctcgcc
aacgcggaggatcttccggcccacggcgaggccgtgcgtctgcggttcgaggctctccag
tga

DBGET integrated database retrieval system