KEGG   Rhodococcus equi: REQ_28420Help
Entry
REQ_28420         CDS       T01352                                 

Gene name
sucB
Definition
dihydrolipoyl-lysine-residue succinyltransferase/dihydrolipoyllysine-residue acetyltransferase sucb
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
req  Rhodococcus equi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_28420 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REQ_28420 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    REQ_28420 (sucB)
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     REQ_28420 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3022800..3024560
Genome map
AA seq 586 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDVVDIGGELAVIGEAGEAPAAEATPAPAAEETPAPAEETPAPAAESAPAPAAEPAA
APSDGSSSGTPVTMPELGESVTEGTVTRWLKAVGDEVAVDEPLLEVSTDKVDTEIPSPVA
GVLLEISAQEDDVVDVGGQLAVIGSGAPAAAAPAAPAPAPEPTPAPAPEPTPAPAPEPTP
APAAAAPAPAAAPAAPAAAPAPAAAPTQSTDNAPYVTPLVRKLAADNNVDLSKVSGTGVG
GRIRKQDVLAAADAAKAPAAAPAAAAPAAAAPAPAATAGVRPELAHLRGTTQKVNRIRQI
TAVKTRESLQSTAQLTQTFEVDVTRIAALRAQAKADFAEREGVNLTFLPFFAKAVVEALK
VHPNVNASYNEDAKEITYHAAEHLGIAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAKR
ARTGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVVQDENGNE
SIGVRSMCYLPLTYDHRLVDGADAGRFLTTIKQRLEEASFEADLGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagccctgggtgaatccgtcaccgagggaactgtcacg
cggtggctcaagcaggaaggggacacggtcgaagtagacgagccgttgctcgaagtctcc
accgacaaggtcgacaccgagatcccgtcgcccgctgccggcgtcctgacgaagatcgtc
gcgcaggaggacgacgtcgtcgacatcggtggcgagctggccgtgatcggtgaggccggc
gaggcgcctgccgccgaggccactcccgctcccgccgccgaggagactccggccccagcc
gaggagactccggctcccgccgccgagtctgcaccggctccggccgccgagcccgccgct
gctccttccgacggttcctcgtccggcaccccggtcacgatgccggagctgggcgagtcg
gtcaccgagggcaccgtcacccgctggctcaaggccgtcggtgacgaggttgccgtcgac
gagcccctcctcgaggtctcgacggacaaggtcgacaccgagatcccgtcgcccgtcgcc
ggtgtgctgctcgagatcagcgcgcaggaggacgacgtcgtcgacgtgggcggccagctc
gccgtcatcggctccggagctccggcggccgctgccccggccgctccggctcccgcaccc
gagcccaccccggctcccgcacccgagcccaccccggctccggcacccgagcccaccccg
gctcccgccgctgctgctccggctccggctgccgcaccggccgcccccgctgctgctccc
gccccggccgccgcaccgacccagtcgaccgacaacgcgccgtacgtcaccccgctcgtg
cgcaagctcgccgccgacaacaacgtcgacctgtcgaaggtctcgggcacgggcgtcggt
ggacgcatccgcaagcaggacgtcctcgccgccgccgacgccgccaaggctcccgccgcc
gctccggctgcagccgcccccgctgccgccgctccggcccccgccgcgaccgcgggtgtg
cgtccggaactcgcgcacctgcgtggcaccacgcagaaggtcaaccggatccgtcagatc
acggccgtcaagacccgcgaatcgctgcagagcaccgctcagctgacccagaccttcgag
gtcgacgtcacccggatcgcggcgctgcgtgcgcaggcgaaggccgacttcgccgagcgc
gagggcgtcaacctgacgttcctgccgttcttcgcgaaggccgtcgtcgaggccctcaag
gttcacccgaacgtgaacgcgagctacaacgaggacgccaaggagatcacgtaccacgct
gccgagcacctgggcatcgcggtcgacaccgagcagggcctgctctcgccggtcatccac
aacgcgggcgacctgtcgctggccggcctggcccgcgcgatcgccgacatcgccaagcgt
gcccgcaccggtggcctcaagccggacgagttgtccggtggcacgttcacgatcaccaac
atcggtagccagggcgccctgttcgacaccccgatcctggtgccgccgcaggctgcgatg
ctgggcaccggcgcgatcgtcaagcgcccggtcgtggtccaggacgagaacggcaacgag
tccatcggcgtccgctcgatgtgctacttgccgctcacctacgaccaccgcctggtcgac
ggcgcggatgcgggtcgtttcctgaccaccatcaagcagcgcctcgaggaggcgtcgttc
gaggccgatctgggcctgtga

DBGET integrated database retrieval system