KEGG   Rhodococcus equi: REQ_28420Help
Entry
REQ_28420         CDS       T01352                                 

Gene name
sucB
Definition
dihydrolipoyl-lysine-residue succinyltransferase/dihydrolipoyllysine-residue acetyltransferase sucb
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
req  Rhodococcus equi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_28420 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REQ_28420 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    REQ_28420 (sucB)
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     REQ_28420 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3022800..3024560
Genome map
AA seq 586 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDVVDIGGELAVIGEAGEAPAAEATPAPAAEETPAPAEETPAPAAESAPAPAAEPAA
APSDGSSSGTPVTMPELGESVTEGTVTRWLKAVGDEVAVDEPLLEVSTDKVDTEIPSPVA
GVLLEISAQEDDVVDVGGQLAVIGSGAPAAAAPAAPAPAPEPTPAPAPEPTPAPAPEPTP
APAAAAPAPAAAPAAPAAAPAPAAAPTQSTDNAPYVTPLVRKLAADNNVDLSKVSGTGVG
GRIRKQDVLAAADAAKAPAAAPAAAAPAAAAPAPAATAGVRPELAHLRGTTQKVNRIRQI
TAVKTRESLQSTAQLTQTFEVDVTRIAALRAQAKADFAEREGVNLTFLPFFAKAVVEALK
VHPNVNASYNEDAKEITYHAAEHLGIAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAKR
ARTGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVVQDENGNE
SIGVRSMCYLPLTYDHRLVDGADAGRFLTTIKQRLEEASFEADLGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagccctgggtgaatccgtcaccgagggaactgtcacg
cggtggctcaagcaggaaggggacacggtcgaagtagacgagccgttgctcgaagtctcc
accgacaaggtcgacaccgagatcccgtcgcccgctgccggcgtcctgacgaagatcgtc
gcgcaggaggacgacgtcgtcgacatcggtggcgagctggccgtgatcggtgaggccggc
gaggcgcctgccgccgaggccactcccgctcccgccgccgaggagactccggccccagcc
gaggagactccggctcccgccgccgagtctgcaccggctccggccgccgagcccgccgct
gctccttccgacggttcctcgtccggcaccccggtcacgatgccggagctgggcgagtcg
gtcaccgagggcaccgtcacccgctggctcaaggccgtcggtgacgaggttgccgtcgac
gagcccctcctcgaggtctcgacggacaaggtcgacaccgagatcccgtcgcccgtcgcc
ggtgtgctgctcgagatcagcgcgcaggaggacgacgtcgtcgacgtgggcggccagctc
gccgtcatcggctccggagctccggcggccgctgccccggccgctccggctcccgcaccc
gagcccaccccggctcccgcacccgagcccaccccggctccggcacccgagcccaccccg
gctcccgccgctgctgctccggctccggctgccgcaccggccgcccccgctgctgctccc
gccccggccgccgcaccgacccagtcgaccgacaacgcgccgtacgtcaccccgctcgtg
cgcaagctcgccgccgacaacaacgtcgacctgtcgaaggtctcgggcacgggcgtcggt
ggacgcatccgcaagcaggacgtcctcgccgccgccgacgccgccaaggctcccgccgcc
gctccggctgcagccgcccccgctgccgccgctccggcccccgccgcgaccgcgggtgtg
cgtccggaactcgcgcacctgcgtggcaccacgcagaaggtcaaccggatccgtcagatc
acggccgtcaagacccgcgaatcgctgcagagcaccgctcagctgacccagaccttcgag
gtcgacgtcacccggatcgcggcgctgcgtgcgcaggcgaaggccgacttcgccgagcgc
gagggcgtcaacctgacgttcctgccgttcttcgcgaaggccgtcgtcgaggccctcaag
gttcacccgaacgtgaacgcgagctacaacgaggacgccaaggagatcacgtaccacgct
gccgagcacctgggcatcgcggtcgacaccgagcagggcctgctctcgccggtcatccac
aacgcgggcgacctgtcgctggccggcctggcccgcgcgatcgccgacatcgccaagcgt
gcccgcaccggtggcctcaagccggacgagttgtccggtggcacgttcacgatcaccaac
atcggtagccagggcgccctgttcgacaccccgatcctggtgccgccgcaggctgcgatg
ctgggcaccggcgcgatcgtcaagcgcccggtcgtggtccaggacgagaacggcaacgag
tccatcggcgtccgctcgatgtgctacttgccgctcacctacgaccaccgcctggtcgac
ggcgcggatgcgggtcgtttcctgaccaccatcaagcagcgcctcgaggaggcgtcgttc
gaggccgatctgggcctgtga

DBGET integrated database retrieval system