KEGG   Rhodococcus hoagii: REQ_28420Help
Entry
REQ_28420         CDS       T01352                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyl-lysine-residue succinyltransferase/dihydrolipoyllysine-residue acetyltransferase SucB
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
req  Rhodococcus hoagii
Pathway
req00020  Citrate cycle (TCA cycle)
req00310  Lysine degradation
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REQ_28420 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    REQ_28420 (sucB)
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     REQ_28420 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: CBH48861
UniProt: E4WIV3
Position
3022800..3024560
Genome map
AA seq 586 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTKIV
AQEDDVVDIGGELAVIGEAGEAPAAEATPAPAAEETPAPAEETPAPAAESAPAPAAEPAA
APSDGSSSGTPVTMPELGESVTEGTVTRWLKAVGDEVAVDEPLLEVSTDKVDTEIPSPVA
GVLLEISAQEDDVVDVGGQLAVIGSGAPAAAAPAAPAPAPEPTPAPAPEPTPAPAPEPTP
APAAAAPAPAAAPAAPAAAPAPAAAPTQSTDNAPYVTPLVRKLAADNNVDLSKVSGTGVG
GRIRKQDVLAAADAAKAPAAAPAAAAPAAAAPAPAATAGVRPELAHLRGTTQKVNRIRQI
TAVKTRESLQSTAQLTQTFEVDVTRIAALRAQAKADFAEREGVNLTFLPFFAKAVVEALK
VHPNVNASYNEDAKEITYHAAEHLGIAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAKR
ARTGGLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVVQDENGNE
SIGVRSMCYLPLTYDHRLVDGADAGRFLTTIKQRLEEASFEADLGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagccctgggtgaatccgtcaccgagggaactgtcacg
cggtggctcaagcaggaaggggacacggtcgaagtagacgagccgttgctcgaagtctcc
accgacaaggtcgacaccgagatcccgtcgcccgctgccggcgtcctgacgaagatcgtc
gcgcaggaggacgacgtcgtcgacatcggtggcgagctggccgtgatcggtgaggccggc
gaggcgcctgccgccgaggccactcccgctcccgccgccgaggagactccggccccagcc
gaggagactccggctcccgccgccgagtctgcaccggctccggccgccgagcccgccgct
gctccttccgacggttcctcgtccggcaccccggtcacgatgccggagctgggcgagtcg
gtcaccgagggcaccgtcacccgctggctcaaggccgtcggtgacgaggttgccgtcgac
gagcccctcctcgaggtctcgacggacaaggtcgacaccgagatcccgtcgcccgtcgcc
ggtgtgctgctcgagatcagcgcgcaggaggacgacgtcgtcgacgtgggcggccagctc
gccgtcatcggctccggagctccggcggccgctgccccggccgctccggctcccgcaccc
gagcccaccccggctcccgcacccgagcccaccccggctccggcacccgagcccaccccg
gctcccgccgctgctgctccggctccggctgccgcaccggccgcccccgctgctgctccc
gccccggccgccgcaccgacccagtcgaccgacaacgcgccgtacgtcaccccgctcgtg
cgcaagctcgccgccgacaacaacgtcgacctgtcgaaggtctcgggcacgggcgtcggt
ggacgcatccgcaagcaggacgtcctcgccgccgccgacgccgccaaggctcccgccgcc
gctccggctgcagccgcccccgctgccgccgctccggcccccgccgcgaccgcgggtgtg
cgtccggaactcgcgcacctgcgtggcaccacgcagaaggtcaaccggatccgtcagatc
acggccgtcaagacccgcgaatcgctgcagagcaccgctcagctgacccagaccttcgag
gtcgacgtcacccggatcgcggcgctgcgtgcgcaggcgaaggccgacttcgccgagcgc
gagggcgtcaacctgacgttcctgccgttcttcgcgaaggccgtcgtcgaggccctcaag
gttcacccgaacgtgaacgcgagctacaacgaggacgccaaggagatcacgtaccacgct
gccgagcacctgggcatcgcggtcgacaccgagcagggcctgctctcgccggtcatccac
aacgcgggcgacctgtcgctggccggcctggcccgcgcgatcgccgacatcgccaagcgt
gcccgcaccggtggcctcaagccggacgagttgtccggtggcacgttcacgatcaccaac
atcggtagccagggcgccctgttcgacaccccgatcctggtgccgccgcaggctgcgatg
ctgggcaccggcgcgatcgtcaagcgcccggtcgtggtccaggacgagaacggcaacgag
tccatcggcgtccgctcgatgtgctacttgccgctcacctacgaccaccgcctggtcgac
ggcgcggatgcgggtcgtttcctgaccaccatcaagcagcgcctcgaggaggcgtcgttc
gaggccgatctgggcctgtga

DBGET integrated database retrieval system