KEGG   Rhodococcus equi: REQ_29810Help
Entry
REQ_29810         CDS       T01352                                 

Gene name
proB
Definition
glutamate 5-kinase prob
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
req  Rhodococcus equi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    REQ_29810 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    REQ_29810 (proB)
Enzymes [BR:req01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     REQ_29810 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3161870..3162970)
Genome map
AA seq 366 aa AA seqDB search
MSETRAAIASARSIVVKIGSSALTSLIGGLDVGRLNLLADALEARMRAGSDVVVVSSGAV
GAGLAPLGLTHRPRDLATKQAAASVGQLALAHAWGTSFARYGRTVGQVLLTADDIARRTQ
HRNAQRTLDRLRALHAVAIVNENDTVATTELRFGDNDRLAALVAHLVGADALVLLSDVDG
LYDGDPRKGGATLIPEVNSPEDLDGVVAGSGGALGTGGMASKLSAARLAADSGVPVLLTA
ASDAATALTTADVGTVFAARPHRMSARKFWVRHAADTQGALHLDAGAVRAVVERRRSLLP
AGITAVGGRFYGGDVVSIVGPDDRPVARGVVAYDSTEIEDMLGHSTTDLPADMHRPVVHA
DDLVAL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagaccagagcggccatcgcgtccgcgcgcagcatcgtcgtcaagatcggatcc
tcggcactcacgagcctgatcggcggactcgacgtcggacggctgaacctgctcgcggac
gcgctggaggcgcggatgcgggccgggtcggacgtcgtcgtggtgtcgtcgggcgctgtg
ggagcgggcctggctccgctcggattgacgcaccgcccaagggatctcgcgacgaaacag
gcggccgccagcgtcggtcagctggccttggcgcatgcgtggggcacgtcgttcgcacga
tacgggcgcactgtcggacaggtgttgctcactgccgacgacatcgcccgccgcactcag
caccgcaacgcgcagcgcaccctcgaccgactgcgggccctgcacgcggtcgcgatcgtc
aacgagaacgacacggtcgcgacgacggaactgcggttcggcgacaacgatcggctcgcg
gcactcgtcgcgcacctggtcggggcggacgccctggtgttgctctcggacgtcgacggc
ctctacgacggcgacccccgaaaaggcggcgccacactgattccggaggtcaacagcccc
gaggacctcgacggtgtggtcgccgggtcaggcggagcattgggtacgggcgggatggcg
tcaaagctgtcggcggcccggctggcggccgactcgggtgtgccggtgctgttgaccgcg
gcatcggacgccgcgacggcactgaccaccgccgacgtcggcaccgtgttcgcggcccgg
ccgcaccggatgtcggcccgcaagttctgggtcaggcacgctgcggacacgcagggcgcg
ctgcacctcgacgcgggcgccgtacgggcggtcgtcgagcgtcggcgttcgctgctgccg
gcggggatcaccgccgtcggcggccggttctacggcggcgacgtggtgtccatcgtcgga
cccgacgaccgtcccgtcgcgcgcggcgtggtggcgtacgactcgacggagatcgaggac
atgctgggccactcgaccacggaccttcccgccgacatgcatcgtcccgtcgtgcacgcc
gacgacctggtggctctgtag

DBGET integrated database retrieval system