KEGG   Rhodococcus equi: REQ_31560Help
Entry
REQ_31560         CDS       T01352                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
req  Rhodococcus equi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:req01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:req01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:req00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:req00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:req00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:req00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:req00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3357371..3358402)
Genome map
AA seq 343 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRTADSRYGSTVVGFRDGWRGLLEDRKVQMRNEDRIDR
ILARGGTILGTARVNPQKLHDGLDRIKQTLDDNGIDVLIPIGGEGTLTAGSWLAESGVPV
VGVPKTIDNDIDCTDVTFGFDTALTIATEAIDRLHTTAESHQRVMLVEVMGRHAGWIALQ
SGMASGAHLTLVPEVPFDVDEVCALVKKRFQRGDSHFICVVAEGAAPDPESMTLREGGID
EFGHKIFTGVAQQLAVEIERRIGKEVRTTVLGHVQRGGTPTPYDRVLATRFGVHATDAAH
NGQFGQMVALHGTNIELVPLSEATKQLKTVPVERYREAAAFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggaatactcaccggaggcggcgactgccccggtctcaacgccgtgatccgc
gccgtcgtgcgcaccgcggacagtcggtacggcagcaccgtcgtcggattccgggacggc
tggcgcggcctgctcgaggaccgcaaggtccagatgcggaacgaggaccggatcgaccgc
atcctcgcgcgcggcggcacgatcctcggcaccgcccgcgtcaacccgcagaaactgcac
gacggtctcgaccggatcaagcagaccctcgacgacaacggcatcgacgtcctcatcccg
atcggcggcgagggcacgctcacggccggcagttggctcgccgagagcggcgtgcccgtc
gtcggcgttccgaagacgatcgacaacgacatcgactgcacggacgtcacgttcgggttc
gacacggcactgacgatcgcgaccgaggcgatcgaccgcctgcacaccaccgccgagtcg
caccagcgcgtgatgctcgtcgaggtgatgggccggcacgccgggtggatcgcactgcag
tccggcatggcgtccggcgcgcacctgacactggtgccggaggtgccgttcgatgtcgac
gaggtctgcgcactggtcaagaagcggttccagcgcggtgactcgcacttcatctgtgtg
gtcgccgagggagcggcgccggacccggagtcgatgacgctgcgtgagggcgggatcgac
gagttcgggcacaagatcttcacgggcgtcgcgcagcagttggcggtcgagatcgagcga
cgcatcggcaaggaggtgcgcacaacggtgctcggtcacgtgcagcgcggcggcacaccc
accccgtacgaccgggtgctggcgacccggttcggcgtccatgcgaccgacgcggcgcac
aacggacagttcgggcagatggtggcgctgcacggcacgaacatcgagttggtgccgctg
tcggaggcgaccaagcaactcaagacggtgcccgtcgagcgctaccgggaggcggccgcg
ttcttcgggtga

DBGET integrated database retrieval system