KEGG   Rhodococcus equi: REQ_31750Help
Entry
REQ_31750         CDS       T01352                                 

Definition
glycosyl hydrolase family 57
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
req  Rhodococcus equi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REQ_31750
Enzymes [BR:req01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     REQ_31750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3376909..3378468
Genome map
AA seq 519 aa AA seqDB search
MTSREPGMFCLVLHSHLPWLANHGRWPVGEEWLYQSWAATYLPVTAVLRRLAAEGHSRML
TLGVTPVLAAQLDDPHCLDGMHHWLGNWQIRAHEAAGMPSASHKELGAREHRASAAALAD
FETRWRHGGSAVLRELIDAEAIELLGGPLAHPFQPLLDERLRAFSLTEGLADAHARWGHT
PAGIWAPECGYTPGMERGYASAGVSHFMVDGPALRGDTSAGRPVWGSDVVAFGRDLEVSY
RVWSPKTGYPGHPAYRDFHTYDHDTGLKPARVTGRSVPSEKKAPYDPESAAAALDKHVDD
FVETVRRRLRSESDRIGKGALVVAAFDTELFGHWWYEGPQWLEKVLRALPEAGIRVGTLA
DARASGYVGEPVELQDSSWGSGKDWRVWAGDQVQDLVQLNAEVVQTALDTIDKSRDANPG
RPELRNRVHDQMLRETLMTVSSDWAFMVSKDSAAGYARDRAHKHAHALREIADAVASGRD
DLARRLADGWNAADGLFPALDARRLPGRRTETAAFAGSV
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcgcgcgagccgggcatgttctgcctggtcctgcactcgcacctgccgtggctc
gccaaccacggccggtggccggtgggcgaggagtggctgtaccagtcgtgggcagctacc
tacctgcccgtcaccgctgtgctccgccgcctcgccgccgaggggcactcgcggatgctg
acgctcggcgtcaccccggtcctcgcggctcagctcgacgacccgcactgcctcgacggg
atgcaccactggctcggcaactggcagatccgcgcccacgaggccgcggggatgccgtcg
gcctcgcacaaggagctcggcgcgcgcgagcaccgcgcgtccgcggcagccctggcggac
ttcgaaacccgttggcgccacggcggttccgccgtcctgcgggaactgatcgacgccgag
gcgatcgaactgctcggcggtccgctcgcgcacccgttccagccgctgctcgacgagcgg
ttgcgggcgttctccctcaccgagggcctcgccgacgcgcacgcccgctggggccacacc
ccggccgggatctgggcacccgagtgcggctacacgcccggcatggaacgcgggtacgcc
tccgcgggcgtgtcgcacttcatggtcgacggacctgcgctgcgcggcgacacgtccgcc
ggtcggccggtctggggctccgacgtcgtcgcgttcggtcgcgatctcgaggtgagctac
cgcgtgtggtcgccgaagaccgggtaccccggtcacccggcctaccgggacttccacacc
tacgaccacgacaccgggctcaagcccgcccgggtcaccgggcgctcggtgccgtcggag
aagaaggcaccgtacgaccccgagtcggcggcggccgccctcgacaagcacgtcgacgac
ttcgtcgagaccgtgcgccgacgactgcgcagcgagtccgatcgcatcggtaagggcgcc
ctcgtcgtcgccgcgttcgacaccgaactgttcgggcactggtggtacgagggcccgcag
tggctcgagaaggtgttgcgcgcccttcccgaggccggcatccgtgtcggcaccctcgcc
gacgcccgcgcctccggttacgtgggcgaaccggtggagttgcaggactcgtcgtggggg
tcgggcaaggactggcgggtgtgggccggagaccaggtgcaggacctggtccagctcaac
gcggaggtcgtgcagaccgcgctggacacgatcgacaagtcccgcgacgcgaatccgggc
agaccggaacttcgcaatcgggtccacgaccagatgttgcgtgagacgctgatgacggtc
tccagcgactgggccttcatggtcagtaaggattcggcggcgggatacgcccgcgaccgg
gcccacaagcacgcccacgcgctgcgggagatcgccgacgccgtcgcgtccggccgcgac
gatctcgcacgacgtctcgcggacggatggaacgccgccgacggcctcttccccgcactc
gacgcgcggcgcctgcccggtcgccggaccgaaacagccgcattcgctgggagcgtgtga

DBGET integrated database retrieval system