KEGG   Rhodococcus equi: REQ_31760Help
Entry
REQ_31760         CDS       T01352                                 

Definition
glycogen/starch synthase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
req  Rhodococcus equi
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REQ_31760
Enzymes [BR:req01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     REQ_31760
Glycosyltransferases [BR:req01003]
 Polysaccharide
  Storage polysaccharide
   REQ_31760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3378468..3379712
Genome map
AA seq 414 aa AA seqDB search
MKILIVSWEYPPVVVGGLGRHVHHLATELAAAGHEVVVLSRRPSGTDASTHPTVTEIADG
VLVVAVAEDPPHFIFGEDMLAWTLAMGHAMVRAGVALAKEGIGAGWQPDVVHAHDWLVAH
PAIALAEFYDVPLVSTLHASEAGRHSGWISGRINRQVHSVEWWLANESDSIITCSASMHD
EVTELYGPELPPITVIRNGIDVTTWSFRPRAPRSGPATLLYVGRLEYEKGVQDAIAALPR
IRRSHPGTTLAVAGEGTQFEWLQQQARTHRVARSVTFLGNLDHEELLGWLHGADAIVLPS
RYEPFGIIALEAAAAGTPLIASTAGGLGEAVVDGVTGLSFEPGDVDGLTSAAREVLDDPA
AAQRRAVAARERLTADFDWHKVAEETVQVYAAAKRRVRHPLARPQIPERPLPGR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctcatcgtgtcgtgggagtacccgccggtcgtcgtcggcgggctggggcgg
cacgtccaccatctggcgacggaactcgccgcggccggccacgaggtggtcgtgctgtcg
cgccggccgtcgggtaccgacgcgtcgacgcatccgacggtcaccgagatcgccgacgga
gtgctcgtggtcgcggtcgccgaggatccgccgcacttcatcttcggcgaggacatgctg
gcgtggacgctcgccatgggtcacgcgatggtccgcgccggcgtcgcactggcgaaggag
ggcatcggcgcgggctggcagcccgacgtcgtgcacgcccacgactggctggtggcgcac
cccgccatcgcactggccgagttctacgacgtcccgctggtctcgacgctgcatgcctcg
gaagccggtcggcacagcggctggatctcgggccggatcaaccgccaggtgcactcggtg
gagtggtggctggccaacgagtccgactcgatcatcacgtgctcggcgtcgatgcacgac
gaggtcaccgagctctacggcccggagctgccgccgatcaccgtgatccgcaacgggatc
gacgtcaccacctggagcttccggccccgcgcgccgcggtccgggccggcgaccctgctg
tacgtgggacgactcgagtacgagaagggcgtacaggacgcgatcgccgcgctgccgcgg
attcggcgcagccaccccggcacgacgctcgccgtcgccggtgaaggcacgcagttcgag
tggctgcagcagcaggcccgcacgcatcgggtcgcgcgttcggtgacgttcctgggcaac
ctcgaccacgaggagctgctcggctggctgcacggagccgacgcgatcgtcctgcccagt
cgatacgagccgttcggcatcatcgccctcgaggcggccgccgcgggcaccccgctgatc
gcctccaccgcgggcgggctcggcgaggccgtggtggacggggtcacgggcctgtcgttc
gagccgggcgacgtcgacgggctcacctcggcggcgcgggaggtgctcgacgatccggcc
gccgcgcagcggcgtgcggtggccgcacgagagcgtctcaccgccgacttcgactggcac
aaggtggccgaggagaccgtgcaggtgtacgccgccgcgaagcgacgggtgcggcatccg
ctggcgcgcccgcagattccggagcgtccgctgcccggtcggtag

DBGET integrated database retrieval system