KEGG   Rhodococcus hoagii: REQ_32890Help
Entry
REQ_32890         CDS       T01352                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
req  Rhodococcus hoagii
Pathway
req00860  Porphyrin and chlorophyll metabolism
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
Module
req_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    REQ_32890
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     REQ_32890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CBH49286
UniProt: E4WK27
Position
complement(3496983..3498152)
Genome map
AA seq 389 aa AA seqDB search
MTAGGPPRGDELRGFTVGITASRRADELATLLVRRGADVVHAPAIRIIPLADDTELARVT
ETIVADPPDVIVATTGIGFRGWMGAAEGWGTGEELLTALGSTRILARGPKATGAVRAAGL
REEWSPESESSAEVLEHLLGEGIAGRRIAVQLHGATTEWEPAPDFCAALRAAGAHVIAVP
VYRWTPPDDCSAMDRLIESVGCGGLDAVSFTSAPAVASILGRAKQTGALEPLLRAFDGRV
LAACVGPVTAAPLTALGAPTTMPARSRLGSLARHIADELPRRDAQVRAGGHELSVRGSCV
VVDGEVKVLSPAGMALVRRLAERPGMVVSRADLLASLPGGSGDPHAVETAIARLRSHLGA
PKAVQTVVKRGYRLALDPAEYDRLLEASR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgacggctggggggccgccgcgtggcgacgagctgcgcggcttcacggtggggatcacg
gcgtcgcgtcgggcggacgagctcgcgacgctgctcgtccggcggggtgcggacgtcgtg
cacgcgccggcgatccggatcatcccgctcgccgacgacaccgaactggcccgtgtgacc
gagacgatcgtcgcggacccgccggacgtgatcgtcgcgaccaccggcatcggtttccgg
ggctggatgggtgcggccgagggctggggaacgggcgaggaactgctcaccgcgctgggg
tccacgaggatcctggctcgtggtcccaaggcgaccggagcggtgcgcgccgccggcctg
cgcgaggagtggtcgccggaatccgagtcgtcggcggaggtgctcgaacatctgttgggc
gagggcatcgcgggccgacgaatcgctgtgcaactgcacggtgcaaccaccgaatgggaa
cccgcaccggacttctgcgcggcgctgcgggccgccggggcccacgtgatcgcggtgccc
gtgtaccgatggacgccgccggacgactgcagcgcgatggaccggctgatcgagtccgtc
gggtgcggtgggctggacgcggtgagcttcacgagtgcgcccgcggtcgcctcgatcctg
ggccgcgccaagcagaccggtgcgctcgaaccgctgctccgggcgttcgacgggcgggtg
ctcgcggcgtgtgtcggacccgtcaccgccgcgccgttgaccgcactcggggcacctacg
acgatgccggcacgctcacgtctggggtcgctggcccggcacatcgcggacgagttgccg
cggcgggacgcgcaggtgcgggcgggcggccacgaactgagcgtgcgcggctcgtgcgtc
gtcgtcgacggcgaggtcaaggtgctctcacccgccggaatggcactcgtacgacgcctg
gcggagcggcccggcatggtggtctcccgtgcggacctgctggcgtcgctccccggcggc
agcggtgatccgcacgccgtcgagaccgcgatcgcgcggctgcgcagccacctgggggca
cccaaggcggtgcagaccgtcgtcaagcgtggctaccggttggcgctggacccggcggag
tacgaccggctgctcgaggcaagccggtga

DBGET integrated database retrieval system