KEGG   Rhodococcus equi: REQ_33190Help
Entry
REQ_33190         CDS       T01352                                 

Gene name
aroA
Definition
3-phosphoshikimate 1-carboxyvinyltransferase
Orthology
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
req  Rhodococcus equi
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:req01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:req00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3527549..3528880
Genome map
AA seq 443 aa AA seqDB search
MSRESLWRAPRAEAPVDASVTLPGSKSITNRALILAALASGPSTITGALRSRDTDLMIQG
LRALGVAITATPDAATGTTLHVVPGPMTGAAVDCGLAGTVMRFLPPAAALAEGTVAVDGD
EQARTRPLGTILDALRALGADIDGDALPFTVHGHGGLRGGTVTIDASGSSQFVSGLLLSA
ARFDEGVTVRHQGGSLPSMPHIDMTVEMLREAGVTVHTPGESGDADTWKVLPGKIDSVDW
VVEPDLSNATPFLAAAAVTGGTVRVPLWPSRTTQPGDAIRGILAEMGADVRLEEGVLSVT
GPKTLRGIDIDLHDIGELTPTVAALAALADGPSVLRGIAHLRGHETDRLAALATEIGKLG
GAVTETADGLRIEPRPLHGAQWHSYADHRMATAGAILGLVVDGVDIEDVGTTAKTLPGFE
NLWTAMLDETRSASGPAEQEALS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgtgagagcctgtggagagcgccccgagccgaagcccccgtggatgcgtccgtg
acgctgcccggatcgaagtcgatcaccaaccgggcgctgatcctcgcggcgctcgcgtcg
ggaccgtccaccatcaccggcgctctgcgcagccgcgacaccgatctgatgatccagggc
ctgcgcgcgctgggcgtcgccatcaccgccacccccgacgccgcgacgggcaccacgctg
catgtcgtgcccggcccgatgaccggcgccgcggtggactgcgggctcgccggcaccgtg
atgcggttcctgccgcccgccgccgccctggccgagggcaccgtcgccgtcgacggcgac
gagcaggcccgcacccggccgctgggcacgattctcgacgcgctgcgcgcgctcggcgcc
gacatcgacggtgacgcgctgccgttcaccgtgcacggtcacggtggcctgcgcggcggg
acggtgacgatcgacgcctccggctcgtcgcagttcgtgtccgggctgctgctctcggca
gcccgcttcgacgagggtgtgaccgtccggcaccagggcggctcgctgccgtcgatgccg
cacatcgacatgaccgtcgagatgctgcgcgaggcaggcgtcaccgtccacacgccgggc
gagagcggcgacgccgacacctggaaagtgttgccgggcaagatcgattcggtggactgg
gtcgtcgagcccgacctttcgaacgcgacgccgttcctggccgcggccgccgtcaccggt
ggcaccgtgcgggtgccgctgtggccgtcgcgcaccacgcagccgggagatgcgatccgc
ggaatcctcgcggagatgggcgccgacgtccgactggaggagggcgtgctctccgtgacc
gggccgaagacgttgcgcggcatcgacatcgacctgcacgacatcggcgaactcactccc
accgtcgcggcgctggcggccctcgcggacggcccgtcggtgctgcgcggcatcgcgcac
ctgcgcggccacgagaccgatcggctggcggcgctcgccaccgagatcggcaaactgggc
ggcgcggtcaccgagaccgccgacggcctgcgcatcgagccccgaccgctgcacggggcc
cagtggcactcgtacgccgatcaccggatggccaccgccggcgcgatcctcggactcgtg
gtcgacggcgtcgacatcgaggacgtcggcaccacggcgaagacgctgcccgggttcgag
aacttgtggacggccatgctcgacgagacacggtccgcgtcgggacccgccgagcaggag
gcgctgtcctga

DBGET integrated database retrieval system