KEGG   Rhodococcus equi: REQ_33520Help
Entry
REQ_33520         CDS       T01352                                 

Definition
gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
req  Rhodococcus equi
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    REQ_33520
Enzymes [BR:req01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     REQ_33520
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     REQ_33520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3562400..3563767
Genome map
AA seq 455 aa AA seqDB search
MNDRSEPASVRDHGAGRAIEIVPVTGLPEFRPGDDLAGAIAEAAPWLADGDVLVVTSKVF
SKVEGRIVASPTDPDERDAARRRLVDQEAVRVVARKGRTLITENRLGIVQAASGIDGSNV
DGAELALLPEDPDGSARKLRSDIESRLGVDVAVVVTDTMGRAWRIGQIDAAIGASGVPVL
HAYAGAVDGQGNELFVTEVAVADEIAAAGDLVKGKLGGVPVAVVRGLGLEDDGSAAEKLI
RRGPEDLFWLGTAESVEMGRREALLLRRSVREFSHDVVDPDALRDSIAEALTAPAPHHTR
PVRFVWLRSRDVRGRLLDALQQRWRDDLAADGLSAERIERRVRRGDILFRAPEVVIPFCV
PDGAHDYPDERRTRAESTMFTVAVGAAVQGLLVSLATRGLGSCWIGSTIFAADTVRAELD
LPDDWQPLGAIAVGHPVQPLTPRKPVAPGDALVEL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaccggagtgagcctgcgagcgtgcgcgatcacggcgccggtcgggcgatcgag
atcgtgcccgtcaccgggcttcccgagttccggcccggcgacgacctggccggcgcgatc
gcggaggcggcaccgtggctcgccgacggcgacgttctcgtcgtgaccagcaaggtgttc
tcgaaggtcgagggccggatcgtggcctcccccaccgaccccgacgagcgggacgctgcc
aggcggcgcctcgtcgaccaggaggcagtccgggtggtggcccgcaaggggcgcactctc
atcaccgagaaccgactgggcatcgtgcaggcggcgtcgggcatcgacggctcgaacgtg
gacggcgccgaattggcgctgctgcccgaggatccggacggcagtgcccgaaagttgcgg
tccgacatcgagtcccgtctgggcgtcgacgtcgccgtcgtcgtcacggacacgatggga
cgggcgtggcgcatcggccagatcgacgccgcgatcggggcctcgggtgtgccggtcctg
cacgcgtacgccggtgcggtcgacggccagggcaacgaactgttcgtgacggaggtcgcg
gtcgccgacgagatcgcggcggcaggcgatctcgtgaagggcaagctcggtggagtgccc
gtcgcggtcgtccgggggctgggtctcgaagacgacgggtcggccgccgagaagctgatc
cgccgcggacccgaggacctgttctggctcggcaccgcggagtcggtggagatgggtcgc
cgcgaggcgctgctgctgcgccggtcggtgcgtgagttctcccacgacgtcgtcgacccc
gacgcactgcgggactcgatcgcggaagcgctcaccgcacccgcaccgcatcacacccgg
ccggtgcggttcgtgtggctgcgcagccgtgacgtccgcggccgcctgctcgacgcgctg
cagcagcgctggcgcgacgacctcgccgccgacggattgagcgccgagcggatcgaacgt
cgagttcgccgcggcgacatcctcttccgcgcacccgaggtcgtgatcccgttctgcgtg
cccgacggcgcacacgactaccccgacgagcgccgtacccgtgccgagtcgacgatgttc
accgtcgcggtcggcgcggcggtgcagggtctgctggtctcgctcgcgacccgtggcctc
ggcagctgctggatcggttcgacgatcttcgcggccgacaccgtccgggccgagctcgac
cttcccgacgactggcagcccctgggcgcgatcgcggtgggacatccggtgcagccgctg
acgccccgcaagccggtcgcgccgggcgacgccctcgtggagctgtag

DBGET integrated database retrieval system