KEGG   Rhodococcus equi: REQ_34120Help
Entry
REQ_34120         CDS       T01352                                 

Gene name
glpK
Definition
glycerol kinase glpk
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
req  Rhodococcus equi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    REQ_34120 (glpK)
Enzymes [BR:req01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     REQ_34120 (glpK)
Exosome [BR:req04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   REQ_34120 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3624833..3626341
Genome map
AA seq 502 aa AA seqDB search
MTKYIAAIDQGTTSSRCMIFDHDGDVVGVAQKEHEQIFPEPGWVEHDPEEIWTNTREMVG
SVLAKTDLTAKDIAAVGITNQRETTVVWDRETGKPVYNAIVWQDTRTDSLCDELGGDEGR
GRFRETTGLPLSTYFSGPKVRWILDNVDGARERAEAGELAFGTIDSWIIWNLTGGLHITD
VTNASRTLLMDLETLDWDHDICAAMGIPVSMLPEIRSSSEVYGDLALPGISAGIPIAGIL
GDQQAATFGQACLSEGEAKNTYGTGNFLLLNTGTEKVHSEHGLLTTVCYKLGDKPAVYAL
EGSVAVTGSLVQWLRDNLGIIQSAKDIEPLAQTVEDNGGAYFVPAFSGLFAPRWRPDARG
VIAGLTRYVNKGHLARAALEATAYQTREVIEAMRADSGVELTTLKVDGGMVVNETLMQFQ
SDILDVPVTRPVVNETTALGAAYAAGLAVGFWESEDDIRTNWAADKTWKPRMGDAERERL
YAGWNKAVERTYGWTDEDNAST
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagtacatcgccgcgatcgaccaggggacgacctcgagccggtgcatgatcttc
gatcacgacggtgacgtcgtcggcgtcgcacagaaggaacacgagcagatcttcccggag
ccgggctgggtggagcacgatcccgaggagatctggaccaacacccgcgagatggtcggg
tcggtcctggccaagaccgacctgaccgccaaggacatcgccgcggtgggaatcaccaat
cagcgcgaaaccaccgtcgtgtgggatcgcgagaccggaaagcccgtctacaacgcgatc
gtgtggcaggacacccgtaccgacagtctgtgcgacgagctcggcggtgacgagggtcgc
ggacgcttccgcgagaccaccgggctgccgctttcgacgtacttctcggggccgaaggtg
cggtggatcctcgacaacgtggacggcgcacgcgagcgggccgaggccggcgaactcgcc
ttcggcacgatcgactcctggatcatctggaacctcaccggcggtctgcacatcaccgac
gtgaccaacgcctcgcgcactctgctgatggacctcgagaccctcgactgggaccacgac
atctgtgcggcgatgggaatcccggtgtcgatgctgcccgagatccgcagttcgtccgag
gtgtacggcgatctggcgctgcccggcatctcggcgggaatcccgatcgccgggatcctc
ggtgaccagcaggccgcgacgttcggtcaggcgtgcttgtcggagggcgaggccaagaac
acctacggcaccggcaacttccttctgctcaacaccggcaccgagaaggtccacagcgag
cacggtttgctcaccacggtctgctacaagctcggcgacaagcccgccgtctacgctctg
gaggggtcggtggccgtcaccggctcgctggtgcagtggctgcgtgacaacctcggaatc
atccagtctgccaaggacatcgaaccgctggcacagaccgtcgaggacaacggcggtgcg
tacttcgtgcccgccttctcgggtctgttcgcgccgcggtggcgtcccgatgcgcgcggc
gtcatcgccggactcacccgatacgtcaacaagggtcacctggcgcgcgccgctctcgag
gccaccgcgtaccagacccgcgaggtcatcgaggccatgcgcgccgactctggggtcgaa
ctcacgacgctcaaggtcgacggcggcatggtggtcaacgagacactcatgcagttccag
tcggacatcttggatgtcccggtcacgcgtccggtcgtgaacgagaccaccgcgctcggc
gcggcgtacgcggccggcctggccgtcggattctgggagagcgaggacgacatccgcacc
aactgggcggcggacaagacctggaaacctcggatgggcgacgccgagcgcgagcgcctc
tacgccggctggaacaaggccgtcgagcgcacctacggctggaccgacgaggacaacgcc
tccacgtag

DBGET integrated database retrieval system