KEGG   Rhodococcus equi: REQ_34320Help
Entry
REQ_34320         CDS       T01352                                 

Gene name
sdhD2
Definition
succinate dehydrogenase membrane subunit sdhd2
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
req  Rhodococcus equi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_34320 (sdhD2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REQ_34320 (sdhD2)
   00650 Butanoate metabolism
    REQ_34320 (sdhD2)
  Energy metabolism
   00190 Oxidative phosphorylation
    REQ_34320 (sdhD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3643609..3644052
Genome map
AA seq 147 aa AA seqDB search
MTTEAKSLGKAYDRPASLDNPRSPRKPAKNNFELYAWLFMRFSGLALIILVLGHLFIMLM
LDDGVHRINFAFVAGRWSSPFWQFWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRFWLNT
ILVVSMILIMGLGTYVIFTFDPNISAS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaagccaagtctctcggcaaggcgtacgatcgccccgccagcctggacaac
ccccgctcgccgcgcaagccggcgaagaacaacttcgagctctacgcgtggctgttcatg
cgtttctcgggcctggcgctcatcatcctggtcctgggtcacctgttcatcatgctgatg
ctcgacgacggcgtgcaccgcatcaacttcgcgttcgtcgcgggtcgctggtccagcccg
ttctggcagttctgggacctcaccatgctctggctcgcccagctgcacggcggtaacggc
ctgcgcacggtcatcgcggactactcgcgcaaggactccacccggttctggctcaacacg
atcctggtcgtgtcgatgatcctgatcatgggcctgggcacctacgtcatcttcaccttc
gaccccaacatctcggcgagctag

DBGET integrated database retrieval system