KEGG   Rhodococcus equi: REQ_34910Help
Entry
REQ_34910         CDS       T01352                                 

Definition
cholesterol oxidase chod
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
req  Rhodococcus equi
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    REQ_34910
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     REQ_34910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3709717..3711468)
Genome map
AA seq 583 aa AA seqDB search
MGKQRATDYDVLVVGSGFGGSVTALRLVEKGYKVGVLEAGRRYADADFAKTSWDLKRFLW
APALGCYGIQRVHLLRDVLILAGAGVGGGSLNYANTLYKPPASFFQDPQWRDITDWDSEL
TPHYEQARKMLGVVQNPHMTPADEVIKSVAEDMGVGDTFIQTPVGVFFGEPGKTVEDPYF
GGAGPARTGCIECGECMTGCRHGAKNTLIKNYLGLAEKAGATIVPMTTVESLHEASDGTW
DVVTRRTGAKVRKNHKTYTAKYVVVAAGTWGTQHLLHKMKDTGTLPKLSDRLGELTRTNS
ESIVGAGKYKVDPAMELTKGVAITSSFHPTSDTHIEPVRYGKGSNAMGLLQTLMTDGDGP
TPRWVKLLGIIAKNPAQMLRMLSVRNWSERTIIALVMQNLDNSITTYTKRGVLGRRKVTS
RQGHGEPNPTWIPVGNEATRRIADKIDGVAGGTWGEVFNIPLTAHFLGGCTIGADADHGV
IDPYHRVYGYPTLSVVDGAAVSANLGVNPSLTISAQAERAASLWPNKGEQDNRPAQGAPY
QRIPAVAPNSPVVPAGAPAALTLPIVEIRGGQKEESEAGSGVA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagcgtgcaaccgactacgacgtgctcgtcgtcggctccggattcggtggc
agcgtcactgcgctccggctggtcgagaagggctacaaggtcggggtgctcgaggcaggc
cgtcgctatgcggacgccgacttcgccaagacctcgtgggatctcaagcggttcctgtgg
gcgccggccctcggctgctacggcatccagcgcgtccacctgctgcgcgacgtgctgatc
ctcgcgggcgcgggcgtcggcggcgggtcgctcaactacgccaacaccctctacaagccg
cctgcgtcgttcttccaggatccgcagtggcgcgacatcaccgactgggattccgaactc
acgccgcactacgagcaggcccgcaagatgctcggcgtcgtgcagaacccacacatgacg
cccgccgacgaggtcatcaagtcggtcgccgaggacatgggcgtgggcgacacgttcatc
cagacgccggtcggcgtgttcttcggtgagcccggcaagaccgtggaggatccgtacttc
ggcggcgccggccccgcccgcaccggctgcatcgagtgcggcgagtgcatgaccggctgc
cggcacggcgccaagaacacgctgatcaagaactacctcggcctcgccgagaaggccggc
gcgacgatcgtgccgatgaccactgtcgagtcgctgcacgaggcgtcggacggtacgtgg
gacgtcgtgactcggcgtaccggcgccaaggtccgcaagaaccacaagacctacaccgcg
aagtacgtcgtcgtcgcggccgggacgtggggcacccagcacctgctgcacaagatgaag
gacaccggcacgctgcccaagctgtcggaccggttgggcgagctcacccgcaccaactcg
gagtcgatcgtcggagccgggaagtacaaggtcgatcccgcgatggagctcacgaagggt
gtcgcgatcacgtcgtcgttccacccgacgtccgacacccatatcgagcccgtccgctac
ggcaagggctccaacgcgatggggctgctgcagacgctcatgaccgacggtgacggaccc
accccgcggtgggtgaagctgctcggcatcatcgcgaagaacccggcgcagatgttgcgg
atgctgtcggtgcggaactggagcgagcgcacgatcatcgcgctcgtcatgcagaatctc
gacaactcgatcacgacctacaccaagcggggtgtcctcggccgccgcaaggtcaccagc
aggcagggccacggtgagcccaacccgacgtggatcccggtcggcaacgaggccacccgg
cggatcgccgacaagatcgacggcgtcgccggcggcacgtggggcgaggtgttcaacatc
ccgctcacggcgcacttcctcggcgggtgcacgatcggcgccgatgccgaccacggcgtc
atcgacccgtaccaccgcgtgtacggatacccgacgctcagtgtcgtcgacggcgccgcg
gtctcggccaacctgggcgtcaacccgtcgctgaccatcagcgcgcaggccgagcgggcg
gcatcgctgtggccgaacaagggcgagcaggacaatcgacccgcacagggtgctccttac
cagcggattcccgccgtcgcgccgaactcgccggtggtccccgccggagccccggccgcg
ctgaccctgccgatcgtcgagatccgcggaggtcagaaggaggagagcgaggcgggcagc
ggggtcgcctag

DBGET integrated database retrieval system