KEGG   Rhodococcus equi: REQ_34910Help
Entry
REQ_34910         CDS       T01352                                 

Definition
cholesterol oxidase chod
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
req  Rhodococcus equi
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:req00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3709717..3711468)
Genome map
AA seq 583 aa AA seqDB search
MGKQRATDYDVLVVGSGFGGSVTALRLVEKGYKVGVLEAGRRYADADFAKTSWDLKRFLW
APALGCYGIQRVHLLRDVLILAGAGVGGGSLNYANTLYKPPASFFQDPQWRDITDWDSEL
TPHYEQARKMLGVVQNPHMTPADEVIKSVAEDMGVGDTFIQTPVGVFFGEPGKTVEDPYF
GGAGPARTGCIECGECMTGCRHGAKNTLIKNYLGLAEKAGATIVPMTTVESLHEASDGTW
DVVTRRTGAKVRKNHKTYTAKYVVVAAGTWGTQHLLHKMKDTGTLPKLSDRLGELTRTNS
ESIVGAGKYKVDPAMELTKGVAITSSFHPTSDTHIEPVRYGKGSNAMGLLQTLMTDGDGP
TPRWVKLLGIIAKNPAQMLRMLSVRNWSERTIIALVMQNLDNSITTYTKRGVLGRRKVTS
RQGHGEPNPTWIPVGNEATRRIADKIDGVAGGTWGEVFNIPLTAHFLGGCTIGADADHGV
IDPYHRVYGYPTLSVVDGAAVSANLGVNPSLTISAQAERAASLWPNKGEQDNRPAQGAPY
QRIPAVAPNSPVVPAGAPAALTLPIVEIRGGQKEESEAGSGVA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagcgtgcaaccgactacgacgtgctcgtcgtcggctccggattcggtggc
agcgtcactgcgctccggctggtcgagaagggctacaaggtcggggtgctcgaggcaggc
cgtcgctatgcggacgccgacttcgccaagacctcgtgggatctcaagcggttcctgtgg
gcgccggccctcggctgctacggcatccagcgcgtccacctgctgcgcgacgtgctgatc
ctcgcgggcgcgggcgtcggcggcgggtcgctcaactacgccaacaccctctacaagccg
cctgcgtcgttcttccaggatccgcagtggcgcgacatcaccgactgggattccgaactc
acgccgcactacgagcaggcccgcaagatgctcggcgtcgtgcagaacccacacatgacg
cccgccgacgaggtcatcaagtcggtcgccgaggacatgggcgtgggcgacacgttcatc
cagacgccggtcggcgtgttcttcggtgagcccggcaagaccgtggaggatccgtacttc
ggcggcgccggccccgcccgcaccggctgcatcgagtgcggcgagtgcatgaccggctgc
cggcacggcgccaagaacacgctgatcaagaactacctcggcctcgccgagaaggccggc
gcgacgatcgtgccgatgaccactgtcgagtcgctgcacgaggcgtcggacggtacgtgg
gacgtcgtgactcggcgtaccggcgccaaggtccgcaagaaccacaagacctacaccgcg
aagtacgtcgtcgtcgcggccgggacgtggggcacccagcacctgctgcacaagatgaag
gacaccggcacgctgcccaagctgtcggaccggttgggcgagctcacccgcaccaactcg
gagtcgatcgtcggagccgggaagtacaaggtcgatcccgcgatggagctcacgaagggt
gtcgcgatcacgtcgtcgttccacccgacgtccgacacccatatcgagcccgtccgctac
ggcaagggctccaacgcgatggggctgctgcagacgctcatgaccgacggtgacggaccc
accccgcggtgggtgaagctgctcggcatcatcgcgaagaacccggcgcagatgttgcgg
atgctgtcggtgcggaactggagcgagcgcacgatcatcgcgctcgtcatgcagaatctc
gacaactcgatcacgacctacaccaagcggggtgtcctcggccgccgcaaggtcaccagc
aggcagggccacggtgagcccaacccgacgtggatcccggtcggcaacgaggccacccgg
cggatcgccgacaagatcgacggcgtcgccggcggcacgtggggcgaggtgttcaacatc
ccgctcacggcgcacttcctcggcgggtgcacgatcggcgccgatgccgaccacggcgtc
atcgacccgtaccaccgcgtgtacggatacccgacgctcagtgtcgtcgacggcgccgcg
gtctcggccaacctgggcgtcaacccgtcgctgaccatcagcgcgcaggccgagcgggcg
gcatcgctgtggccgaacaagggcgagcaggacaatcgacccgcacagggtgctccttac
cagcggattcccgccgtcgcgccgaactcgccggtggtccccgccggagccccggccgcg
ctgaccctgccgatcgtcgagatccgcggaggtcagaaggaggagagcgaggcgggcagc
ggggtcgcctag

DBGET integrated database retrieval system