KEGG   Rhodococcus equi: REQ_36150Help
Entry
REQ_36150         CDS       T01352                                 

Definition
(GenBank) zinc binding alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
req  Rhodococcus equi
Pathway
req00010  Glycolysis / Gluconeogenesis
req00071  Fatty acid degradation
req00350  Tyrosine metabolism
req00625  Chloroalkane and chloroalkene degradation
req00626  Naphthalene degradation
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_36150
  Lipid metabolism
   00071 Fatty acid degradation
    REQ_36150
  Amino acid metabolism
   00350 Tyrosine metabolism
    REQ_36150
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    REQ_36150
   00626 Naphthalene degradation
    REQ_36150
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     REQ_36150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: CBH49604
UniProt: E4W829
Position
complement(3864481..3865506)
Genome map
AA seq 341 aa AA seqDB search
MAETMKAAVVREFGKPLSIEDVPIPKPGRDQALVKVRSSGVCHTDLHAAKGDWPVKPTLP
FVPGHEGYGEVVEVGEGVTELTVGDLVGNAWLWSTCLECRYCRTGWETLCERQINGGYTV
DGSFAEYMLVDSRFAARVPKGADPIEVAPVLCAGITVYKGLKVSALIPGQWVTISGIGGL
GHVAVQYATAMGLRVAAVDVADSKLALAARHGAELLVNAFEEDPVEKVRQATGGTDAVLV
TAVSPAAFAQAIGMVRRGGTVTFTGLPPGEFPTPIFDTVLKGLTLRGSIVGTRQDMVEAL
DFYARGSIHPTVHARRIEDINDVFDELDRGMIDGRVVLDFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacgatgaaggccgcggtagttcgtgagttcggcaagcccctctcgatcgag
gacgtcccgatcccgaagccgggacgcgatcaggcgctcgtgaaggtgcggtccagcggc
gtctgccatacggacctgcatgccgccaagggagattggcccgtcaagccgacgctgccc
ttcgttccggggcacgagggctacggcgaggtcgtcgaggtgggggagggcgtcaccgaa
ctgacggtgggcgatctcgtgggcaatgcgtggctgtggtcgacgtgcctcgagtgtcgc
tactgccgcacgggctgggagacgctgtgcgagagacagatcaacggtggatacaccgtc
gacggctcgttcgccgagtacatgctggtcgactccaggttcgccgcccgagtgccgaag
ggagccgatccgatcgaggtggcgccggtcctgtgcgccggaatcaccgtctacaagggg
ctcaaggtcagtgccctcatcccgggccagtgggtgaccatttccgggatcggcgggctc
gggcacgtcgcggtgcagtacgccaccgcgatggggttgcgcgtcgccgcggtcgacgtc
gccgactcgaagctcgcgcttgcggcccgccacggcgcggaactgctcgtcaacgcattc
gaggaggatccagtggagaaggtgcggcaggccaccggcggcaccgacgcggtattggtg
accgcggtcagtccggccgcgttcgcgcaggcgatcggcatggtccgacggggtggaacc
gtcacgttcacgggtctgccgcccggcgagttccccaccccgatcttcgacaccgtgctg
aaggggttgacgctgcgcggatcgatcgtcggcacccggcaggacatggtggaggcgctc
gacttctacgcccgcggctcgatccatcccaccgtccacgcgcggcgaatcgaggacatc
aacgatgtcttcgacgaactcgatcgcggcatgatcgacggccgcgtcgtcctggacttc
gcatga

DBGET integrated database retrieval system