KEGG   Rhodococcus hoagii: REQ_36540Help
Entry
REQ_36540         CDS       T01352                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
req  Rhodococcus hoagii
Pathway
req00071  Fatty acid degradation
req00280  Valine, leucine and isoleucine degradation
req00281  Geraniol degradation
req00310  Lysine degradation
req00360  Phenylalanine metabolism
req00362  Benzoate degradation
req00380  Tryptophan metabolism
req00410  beta-Alanine metabolism
req00627  Aminobenzoate degradation
req00640  Propanoate metabolism
req00650  Butanoate metabolism
req00903  Limonene and pinene degradation
req00930  Caprolactam degradation
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01212  Fatty acid metabolism
Module
req_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    REQ_36540
   00650 Butanoate metabolism
    REQ_36540
  Lipid metabolism
   00071 Fatty acid degradation
    REQ_36540
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    REQ_36540
   00310 Lysine degradation
    REQ_36540
   00360 Phenylalanine metabolism
    REQ_36540
   00380 Tryptophan metabolism
    REQ_36540
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    REQ_36540
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    REQ_36540
   00281 Geraniol degradation
    REQ_36540
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    REQ_36540
   00627 Aminobenzoate degradation
    REQ_36540
   00930 Caprolactam degradation
    REQ_36540
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     REQ_36540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CBH49642
UniProt: E4W867
Position
complement(3900210..3900998)
Genome map
AA seq 262 aa AA seqDB search
MTNRQVRYEVADGVATLTLDSPHNRNAISSTLVGQLRQGLTDAQVDDGVRTVVLAHTGGT
FCAGADLSEASAAGADASPDELAAERTRQMTELLRAILELPKPVIARVDGHVRAGGMGLV
GACDIVVAGPDSTFALTEARLGLAASIISLTVVPRLTSRAAGRYFLTGENFGPHEAEAIG
LISEAVQDSGEAVQDLIETLRKCSPQGLAESKKLTTAKVLADFDTFGESLAAQSARLFGS
PEAIEGVTAFLQKRQPSWAAGG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgacaagttcgctacgaagtcgctgacggtgtcgcgacgctcacactcgac
tcgccacacaatcgcaacgcgatatccagcacgctcgtggggcagttgcgccaagggctc
accgacgcacaggtcgatgacggggtgcgcaccgtcgttctcgctcacacgggcggaacc
ttctgcgcgggcgccgatctctcggaagcgagtgcggccggcgccgacgcgagccccgat
gagctcgcggcggagcggacccgccagatgacggagctgttgcgggcgatcctcgagctg
ccgaaaccggtcatcgcgcgggtggacggccacgtgcgcgccggcggaatggggctcgtg
ggcgcgtgtgacatcgtcgtcgcggggccggacagcacctttgcgctgacggaggctcgg
ttgggtctcgccgcgtcgatcatctcgctgacggtcgttcccaggctcacctcgcgcgcg
gccggccggtacttcctgaccggtgagaacttcggcccacacgaggccgaggcgatcggg
ttgatcagcgaagcggtgcaggactccggggaggcggtgcaggacttgatcgagacgctg
cgcaagtgctcaccgcaggggttggcggaatccaagaagctcaccaccgcgaaggtgctc
gcggacttcgacacgttcggggaatcccttgcggcgcagtcggctcggctgttcggcagt
ccggaggccatcgagggtgtgacggcgttcctgcagaagcggcagccgtcgtgggcggcc
ggaggctga

DBGET integrated database retrieval system