KEGG   Rhodococcus equi: REQ_37810Help
Entry
REQ_37810         CDS       T01352                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
req  Rhodococcus equi
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_37810
   01230 Biosynthesis of amino acids
    REQ_37810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_37810
  Energy metabolism
   00680 Methane metabolism
    REQ_37810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REQ_37810
Enzymes [BR:req01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     REQ_37810
Exosome [BR:req04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   REQ_37810
  Exosomal proteins of melanoma cells
   REQ_37810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4024822..4025568)
Genome map
AA seq 248 aa AA seqDB search
MSTGTLVLLRHGESEWNALNLFTGWVDVHLTDKGMAEGKRAGELLAEHNLLPDVLYTSLL
RRAISTANLALDACDRHWIPVIRDWRLNERHYGALQGKNKAQTKAEFGEDQFMLWRRSYD
TPPPPIEAGSEYSQDQDVRYAALPEVPLTECLLDVVKRLVPYWEETIAADLKAGKTVLVT
AHGNSLRALVKHLDGISDEDIAGLNIPTGIPLRYDLDENLKPLNPGGTYLDPAAAAAGAA
AVANQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccggaacacttgtgctgctccgccacggcgagagcgaatggaacgcgctgaac
ctgttcaccggctgggtggacgtgcacctcaccgacaagggcatggccgagggcaagcgt
gccggtgaactgctcgccgagcacaacctgctcccggacgtgctctacacgtcgctgctg
cgtcgcgcgatcagcaccgcgaacctcgcgctcgacgcctgcgaccgccactggatcccc
gtcatccgcgactggcgcctcaacgagcgtcactacggcgcgctgcagggcaagaacaag
gcccagaccaaggccgagttcggcgaggaccagttcatgctgtggcgtcgtagctacgac
accccgccgccgcccatcgaggccggcagcgagtacagccaggaccaggacgtgcgctac
gccgccctgcccgaggtcccgctgaccgagtgcctgctcgacgtcgtcaagcgtctcgtc
ccgtactgggaggagaccatcgcggccgacctgaaggcgggcaagaccgtcctggtcacc
gcgcacggcaactcgctgcgcgcactcgtcaagcatctcgacggcatctccgacgaggac
atcgcgggtctgaacattccgacgggcatcccgctgcgctacgacctggacgagaacctg
aagccgctcaacccgggtggcacctacctcgatccggcggccgccgcggccggtgccgcc
gccgtcgcgaaccagggcgccaagtag

DBGET integrated database retrieval system