KEGG   Rhodococcus equi: REQ_41100Help
Entry
REQ_41100         CDS       T01352                                 

Definition
glycosyl hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
req  Rhodococcus equi
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:req00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:req00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4366510..4367715)
Genome map
AA seq 401 aa AA seqDB search
MSTTVGTMRIRHAFALALCAGLAAGCSSGNGTDTTATSQPSTSESAASSTSTTSQAPPAP
GPFGSAVCGPGFLKSLTERQKLAQLLTVGVTGAADALDVVKSEGIGGIFIGSWTDESMLA
NGEAAQVAEASAVPLMVTIDEEGGRVSRVDQLFGPDPSAREVARTMTTDQAYEMALERGR
KLRSVGITVNFAPDVDVSSQPDDSVIGDRSFSDDPEVVTRYADAYARGMRDAGILPVIKH
FPGHGSASGDSHTGAVTTPPLDQLQKTDLVPFRNLVDTEVGVMLGHLSVPGLTTDGLPAS
LSPQAVDLLRKGTGYDAPPFEGVIFTDDLSGMKAITDRFDIADAVEQALKSGVTSALWLT
TDDVPRVLDHLEDAVAKGRLPQSQVDESVLTVAREKGAVSC
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactacggtcggaaccatgcgaatccgacatgcgttcgccctcgccctgtgcgcc
ggtctcgcggccgggtgctcgtccgggaacgggaccgacaccaccgcgacgtcccagccg
tcgacgtccgaatcagcggcgtcgtcgacgtcgaccacctcgcaggcgccgccggcgccg
ggaccgttcggctccgcggtgtgcggacccggtttcctgaagtcgctcacggagcggcag
aagctggcgcagctgctaacggtgggcgtcacgggtgccgcggacgccctcgacgtcgtg
aagtccgagggcatcggtggcatcttcatcggcagctggaccgacgagtcgatgctcgcg
aacggggaggccgcgcaggtcgcggaagccagcgcggtgccgctcatggtgaccatcgac
gaggagggcggccgggtgtcccgcgtcgaccagctgttcgggccggacccgtcggcgcgg
gaggtcgcgcgcaccatgacgacggaccaggcctacgagatggcactcgagcgcggccgc
aagctgcgcagtgtcgggatcaccgtcaacttcgcccccgacgtcgacgtgagcagccag
ccggacgactcggtgatcggcgaccgatcgttctcggacgatccggaggtggtcacccgg
tacgccgacgcgtacgcccgtggcatgcgcgacgccgggatcctgccggtcatcaagcac
tttccgggccacggatcggcgtccggtgattcgcacaccggcgccgtcaccacgccgccg
ctcgaccagttgcagaagactgacctcgtgccgttccggaacctggtcgacaccgaggtc
ggcgtgatgttgggtcatctcagcgttcccggtctcaccaccgacgggctgccggcgagc
ctgagcccgcaggccgtcgacctgctccggaaggggacgggctacgacgcgcccccgttc
gaaggggtgatcttcaccgacgacctgagcgggatgaaggcgatcaccgatcggttcgac
atcgccgacgcggtggagcaggccctgaagtccggcgtgacgtcggcgctgtggctcacg
accgacgacgtgccgcgggtgctggaccatctcgaggacgcggtcgcgaagggacggttg
ccccagtcgcaggtggacgagtcggtgctgacggtggcgcgcgagaagggcgctgtgagc
tgctga

DBGET integrated database retrieval system