KEGG   Rhodococcus equi: REQ_41810Help
Entry
REQ_41810         CDS       T01352                                 

Definition
hydrogenase small subunit
Orthology
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
req  Rhodococcus equi
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:req00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4443100..4444185)
Genome map
AA seq 361 aa AA seqDB search
MSTPTRAAEKSGTSPEAETDEGAIHVLWINAGLSCDGDSVALTAASQPSVEEIVFGALPG
LPKIAVHWPLIDFECGPQGGADDFIEWFWKADRGELEPFVLVVEGSIPNEQLHDEGYWCG
FGNNPETGQPVTTSEWLDRLAPKATAIVTAGTCSSYGGIHAMAGNPTGAMGVPDYLGWDW
KSKAGLPIVCVPGCPIQPDNLSETLTYLLYQVTNQAPMIPLDDMLRPQWLFGQTVHQGCD
RAGYYEQGDFATEYGSPKCIVKLGCWGPVVKCNVPKRGWMNGIGGCPNVGGICIGCTMPG
FPDKFMPFMDEPPGGILSSSVSEVYGSVIRTLRSVTGRTLDKEPHWRTPGRLLRTGAVRT
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacccacgagagcagccgagaagtccggcacatcgccggaggccgaaaccgac
gagggcgccatccacgtcctgtggatcaacgcgggactcagctgcgacggagattcggtg
gcactcaccgccgccagccagcccagcgtggaggagatcgtcttcggggcgctgccagga
ctgccgaagatcgcggtgcactggccgctgatcgacttcgagtgcgggccgcagggcggc
gccgacgacttcatcgagtggttctggaaagccgaccggggagaactcgaaccgttcgtt
ctggttgtggagggctcgattccgaacgagcaactgcacgacgagggctactggtgcggg
ttcggtaacaacccggagacgggtcagccggtcacgacgagtgagtggctcgaccgactg
gcaccgaaggccacggcgatcgtcacggccggcacctgctcgtcctacggcggcatccac
gcgatggcaggcaatccgacgggcgcgatgggtgtgcccgactacctgggttgggactgg
aagtccaaggccgggctgccgatcgtgtgtgttccgggctgtccgatccagccggacaac
ctgtcggagaccctcacctacctgctgtatcaggtgacgaatcaggcgccgatgattccg
ctcgacgacatgctgcggccgcagtggttgttcggtcagaccgtgcaccaggggtgcgac
cgggccggctactacgaacagggcgacttcgcgaccgagtacggctccccgaaatgcatc
gtgaaactcggttgctggggcccggtcgtcaaatgcaatgtgcccaagcggggttggatg
aacggtatcggaggctgccccaatgtcggcggcatctgcatcggttgcaccatgcccggt
tttcccgacaagttcatgccgttcatggacgaaccgccgggcggcatcctgtcgagctcg
gtgtccgaggtgtacgggtcggtcattcggacgttgcgcagcgtcaccggacgcacgctc
gacaaggaaccccactggcgcacaccagggcgcctgttgaggacgggggccgtgcgtacc
tggtag

DBGET integrated database retrieval system