KEGG   Rhodococcus equi: REQ_42070Help
Entry
REQ_42070         CDS       T01352                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
req  Rhodococcus equi
Pathway
req00360  Phenylalanine metabolism
req00362  Benzoate degradation
req00620  Pyruvate metabolism
req00621  Dioxin degradation
req00622  Xylene degradation
req00650  Butanoate metabolism
req01100  Metabolic pathways
req01120  Microbial metabolism in diverse environments
req01220  Degradation of aromatic compounds
Module
req_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    REQ_42070
   00650 Butanoate metabolism
    REQ_42070
  Amino acid metabolism
   00360 Phenylalanine metabolism
    REQ_42070
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    REQ_42070
   00622 Xylene degradation
    REQ_42070
   00621 Dioxin degradation
    REQ_42070
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     REQ_42070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CBH50174
UniProt: E4W9P9
Position
complement(4472943..4473887)
Genome map
AA seq 314 aa AA seqDB search
MSKVKVAIIGSGNIGTDLMIKVLNHSDHLEMGAMVGIDPASDGLARAASMGVPITAEGVE
GLVGLPNFDEIDIVFDATSAKAHVVNDARLRPLGKRMIDLTPAAIGPFVVPAVNGDEHID
APNVNMVTCGGQATIPMVAAVSRVVPVAYAEIVASIASKSAGPGTRANIDEFTETTSSAI
VSVGGAKRGKAIIILNPAEPPLIMRDTVFCLVDAADPATHDQIRESVAKMVGDVAAYVPG
YRLKQQVQIAEIPADQPVETLIDGGNRPTHQVSIFLEVEGAGHYLPAYAGNLDIMTSAGL
QIAERIAQKKEATR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcaaggtcgcgatcatcggatccggcaacatcggcaccgatctgatgatc
aaggtgctcaaccactccgatcacctcgagatgggcgcgatggtcggtatcgacccggcg
tcggacggtctcgcgcgcgccgcgtccatgggcgtgccgatcaccgccgagggtgtcgag
ggcctcgtcggcctccccaacttcgacgagatcgacatcgtcttcgacgcgacgtcggcc
aaggcccacgtcgtgaacgacgcgcggctgcgtccgctcggcaagcgcatgatcgacctc
acccccgccgcgatcggccccttcgtggtgccggccgtcaacggtgacgagcacatcgac
gctccgaacgtgaacatggtgacctgcggtggccaggccacgatcccgatggtcgcggcc
gtctcccgggtcgtcccggtcgcctacgccgagatcgtcgcctcgatcgcgtcgaagtcc
gccggccccggcacccgcgccaacatcgacgagttcaccgagaccacgtcgagcgcgatc
gtgtccgtcggcggcgccaagcgcggcaaggcgatcatcatcctgaacccggccgagccg
ccgctgatcatgcgcgacacggtcttctgcctggtcgacgctgcggacccggccacccac
gaccagatccgcgagtcggtcgcgaagatggtcggcgacgtcgccgcctacgttcccggc
taccgcctcaagcagcaggtccagatcgccgagatccccgcggaccagccggtcgagacc
ctcatcgacggcggcaaccgcccgacccaccaggtgtcgattttcctcgaggtcgagggc
gcaggacactacctgcccgcctacgcaggcaacctcgacatcatgacctctgccggcctg
cagatcgctgagcgcatcgcccagaagaaggaagccacccgatga

DBGET integrated database retrieval system