KEGG   Rhodococcus erythropolis PR4: RER_03810Help
Entry
RER_03810         CDS       T00881                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00071  Fatty acid degradation
rer00280  Valine, leucine and isoleucine degradation
rer00281  Geraniol degradation
rer00310  Lysine degradation
rer00362  Benzoate degradation
rer00380  Tryptophan metabolism
rer00410  beta-Alanine metabolism
rer00640  Propanoate metabolism
rer00650  Butanoate metabolism
rer00903  Limonene and pinene degradation
rer00930  Caprolactam degradation
rer01040  Biosynthesis of unsaturated fatty acids
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
rer01212  Fatty acid metabolism
Module
rer_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RER_03810 (fadB)
   00650 Butanoate metabolism
    RER_03810 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    RER_03810 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    RER_03810 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_03810 (fadB)
   00310 Lysine degradation
    RER_03810 (fadB)
   00380 Tryptophan metabolism
    RER_03810 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RER_03810 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_03810 (fadB)
   00281 Geraniol degradation
    RER_03810 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_03810 (fadB)
   00930 Caprolactam degradation
    RER_03810 (fadB)
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RER_03810 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RER_03810 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RER_03810 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAH31089
NITE: RER_03810
UniProt: C0ZN37
Position
429759..431900
Genome map
AA seq 713 aa AA seqDB search
MTDQNIINWDQDADGIVVLTINDPNQGANTMNDAYIASMKATVDRLVAEKDSITGAVITS
GKKTFFAGGDLKNMIKVGPEQAEEIYNHSVEIKADLRRLETLGKPVVAAINGAALGGGLE
IALATHHRIAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGLQNALMGVLLQGQQRGPV
QAKEVGLIDEVVGSVEELVPAAKAWIKANPEGGVQPWDVKGYKIPGGTPSTPAFAANLPA
FPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEARYFTSLVTGRVAKNMIQAFF
FDLQSINGGGSRPAGIEKSTIKKVGVLGAGMMGAGIAYVSAKAGFDVVLKDVSIEAANKG
KAYAEGIEAKALSRGKTTQEKSDALLAKITPTADPADFAGVDFVIEAVFESQELKHKVFQ
EIEDIVDPKALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDE
TLARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINEAIGMLAEGVEPATIEQAGMQAGY
PAAPLQLSDELNLTLMQKIRKESADAAKAEGKELPADPAGEVINTLVEKFDRKGKLGGAG
FYDYAEGKRTGLWSGLRENFNSGTSDAPIQDLIDRMLFIEAIETQKCFDENVLITTADAN
IGSIMGIGFPAWTGGVHQFIVGYEGGTAGFVARAKELAAQYGPRFTPPASLGA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagaacatcatcaactgggaccaggacgccgacggcatcgtcgtgctcacc
atcaacgatcccaaccagggcgcaaacaccatgaacgacgcgtacatcgcgtcgatgaag
gccaccgtcgaccgcctggtcgccgagaaggactccatcaccggtgccgtcatcacctca
ggcaagaagaccttcttcgccggtggcgacctcaagaacatgatcaaggtcggccccgag
caggccgaggagatctacaaccacagcgtcgagatcaaggcagacctgcgtcgcctcgaa
actctcggcaagccggtagtcgccgccatcaacggcgcggccctcggcggcggcctcgag
atcgctctcgcgacccaccaccgcatcgcggcagacgtcaagggcgtcaagatcggcctg
cccgaggtcaccctcggcctgctgcccggcggcggcggcgtcgtgcgcaccgtgcggatg
ctcggtctgcagaacgcgctcatgggcgtcctgctccaggggcagcagcgtggacccgtt
caggccaaggaagtcggcctcatcgacgaggtcgtcggctcggtagaagaactggttccg
gctgcgaaggcatggatcaaggccaaccccgaaggcggcgttcagccgtgggatgtcaag
ggctacaagatccctggcggaaccccgtccaccccggcattcgctgccaaccttccggcg
ttccccgcgaacctgcgtaagcagctcaagggtgctccgatgccggctccgcgcgccatc
atggccgcagccgtcgaaggctcgcaggtcgacatcgacaacgcgctcctcatcgaggct
cgctacttcacctcgctggtgaccggccgcgtcgcgaagaacatgattcaggcgttcttc
ttcgacctgcagtcgatcaacggcggcggttcacgtccggcaggcatcgagaagtccacc
atcaagaaggtcggcgtcctcggcgcgggcatgatgggcgcgggcatcgcgtacgtctcc
gcgaaggccggcttcgacgtcgtcctcaaggacgtcagcatcgaggctgccaacaagggc
aaggcgtacgccgaaggcattgaggccaaggcactctcgcgcggcaagaccacgcaggag
aagtccgacgcactcctcgccaagatcaccccgacggctgacccggcagatttcgccggc
gtcgacttcgtcatcgaagcggtcttcgagagtcaggaactcaagcacaaggtgttccag
gagatcgaggacatcgtcgatcccaaggcgttgctgggctcgaacacctcgacgctgccc
atcacgggtctcgccaccggcgtgaagcgtcaggaagacttcatcggcatccacttcttc
tcgcccgtcgacaagatgccgctggtggagatcatccgcggtgagaagacctccgacgag
actctggctcgcgtattcgactacgtccaggcgatccgcaagacgccgatcgtggtcaac
gactcgcgtggcttcttcacctcgcgtgtcatcggaaccttcatcaacgaggccatcggc
atgctcgccgagggcgtcgagcctgccaccatcgagcaggccggcatgcaggccggttac
ccggctgcgccgcttcagctttcggatgagctcaacctcaccctcatgcagaagatccgc
aaggaatctgccgacgccgccaaggccgagggcaaggaactgccggcagatccggccggc
gaggtcatcaacaccctcgtcgagaagttcgatcgtaagggcaagctcggtggagccggc
ttctacgattacgccgagggcaagcgcaccggcctgtggtccggactccgcgagaacttc
aactccggaacctccgatgctccgatccaggacctcatcgatcgcatgctgttcatcgag
gcgatcgagacgcagaagtgcttcgacgagaacgtcctgatcaccacggcggacgccaac
atcggctccatcatgggcatcggattcccggcctggaccggtggcgttcaccagttcatc
gtcggatacgagggcggcacggccggcttcgtcgctcgcgcaaaggaactcgctgcgcag
tacggcccgcggttcaccccgccggcttcgctaggggcatag

DBGET integrated database retrieval system