KEGG   Rhodococcus erythropolis PR4: RER_03810Help
Entry
RER_03810         CDS       T00881                                 

Gene name
fadB
Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_03810 (fadB)
   01212 Fatty acid metabolism
    RER_03810 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RER_03810 (fadB)
   00650 Butanoate metabolism
    RER_03810 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    RER_03810 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    RER_03810 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_03810 (fadB)
   00310 Lysine degradation
    RER_03810 (fadB)
   00380 Tryptophan metabolism
    RER_03810 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RER_03810 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RER_03810 (fadB)
   00281 Geraniol degradation
    RER_03810 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RER_03810 (fadB)
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RER_03810 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RER_03810 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RER_03810 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
429759..431900
Genome map
AA seq 713 aa AA seqDB search
MTDQNIINWDQDADGIVVLTINDPNQGANTMNDAYIASMKATVDRLVAEKDSITGAVITS
GKKTFFAGGDLKNMIKVGPEQAEEIYNHSVEIKADLRRLETLGKPVVAAINGAALGGGLE
IALATHHRIAADVKGVKIGLPEVTLGLLPGGGGVVRTVRMLGLQNALMGVLLQGQQRGPV
QAKEVGLIDEVVGSVEELVPAAKAWIKANPEGGVQPWDVKGYKIPGGTPSTPAFAANLPA
FPANLRKQLKGAPMPAPRAIMAAAVEGSQVDIDNALLIEARYFTSLVTGRVAKNMIQAFF
FDLQSINGGGSRPAGIEKSTIKKVGVLGAGMMGAGIAYVSAKAGFDVVLKDVSIEAANKG
KAYAEGIEAKALSRGKTTQEKSDALLAKITPTADPADFAGVDFVIEAVFESQELKHKVFQ
EIEDIVDPKALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDE
TLARVFDYVQAIRKTPIVVNDSRGFFTSRVIGTFINEAIGMLAEGVEPATIEQAGMQAGY
PAAPLQLSDELNLTLMQKIRKESADAAKAEGKELPADPAGEVINTLVEKFDRKGKLGGAG
FYDYAEGKRTGLWSGLRENFNSGTSDAPIQDLIDRMLFIEAIETQKCFDENVLITTADAN
IGSIMGIGFPAWTGGVHQFIVGYEGGTAGFVARAKELAAQYGPRFTPPASLGA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
gtgactgatcagaacatcatcaactgggaccaggacgccgacggcatcgtcgtgctcacc
atcaacgatcccaaccagggcgcaaacaccatgaacgacgcgtacatcgcgtcgatgaag
gccaccgtcgaccgcctggtcgccgagaaggactccatcaccggtgccgtcatcacctca
ggcaagaagaccttcttcgccggtggcgacctcaagaacatgatcaaggtcggccccgag
caggccgaggagatctacaaccacagcgtcgagatcaaggcagacctgcgtcgcctcgaa
actctcggcaagccggtagtcgccgccatcaacggcgcggccctcggcggcggcctcgag
atcgctctcgcgacccaccaccgcatcgcggcagacgtcaagggcgtcaagatcggcctg
cccgaggtcaccctcggcctgctgcccggcggcggcggcgtcgtgcgcaccgtgcggatg
ctcggtctgcagaacgcgctcatgggcgtcctgctccaggggcagcagcgtggacccgtt
caggccaaggaagtcggcctcatcgacgaggtcgtcggctcggtagaagaactggttccg
gctgcgaaggcatggatcaaggccaaccccgaaggcggcgttcagccgtgggatgtcaag
ggctacaagatccctggcggaaccccgtccaccccggcattcgctgccaaccttccggcg
ttccccgcgaacctgcgtaagcagctcaagggtgctccgatgccggctccgcgcgccatc
atggccgcagccgtcgaaggctcgcaggtcgacatcgacaacgcgctcctcatcgaggct
cgctacttcacctcgctggtgaccggccgcgtcgcgaagaacatgattcaggcgttcttc
ttcgacctgcagtcgatcaacggcggcggttcacgtccggcaggcatcgagaagtccacc
atcaagaaggtcggcgtcctcggcgcgggcatgatgggcgcgggcatcgcgtacgtctcc
gcgaaggccggcttcgacgtcgtcctcaaggacgtcagcatcgaggctgccaacaagggc
aaggcgtacgccgaaggcattgaggccaaggcactctcgcgcggcaagaccacgcaggag
aagtccgacgcactcctcgccaagatcaccccgacggctgacccggcagatttcgccggc
gtcgacttcgtcatcgaagcggtcttcgagagtcaggaactcaagcacaaggtgttccag
gagatcgaggacatcgtcgatcccaaggcgttgctgggctcgaacacctcgacgctgccc
atcacgggtctcgccaccggcgtgaagcgtcaggaagacttcatcggcatccacttcttc
tcgcccgtcgacaagatgccgctggtggagatcatccgcggtgagaagacctccgacgag
actctggctcgcgtattcgactacgtccaggcgatccgcaagacgccgatcgtggtcaac
gactcgcgtggcttcttcacctcgcgtgtcatcggaaccttcatcaacgaggccatcggc
atgctcgccgagggcgtcgagcctgccaccatcgagcaggccggcatgcaggccggttac
ccggctgcgccgcttcagctttcggatgagctcaacctcaccctcatgcagaagatccgc
aaggaatctgccgacgccgccaaggccgagggcaaggaactgccggcagatccggccggc
gaggtcatcaacaccctcgtcgagaagttcgatcgtaagggcaagctcggtggagccggc
ttctacgattacgccgagggcaagcgcaccggcctgtggtccggactccgcgagaacttc
aactccggaacctccgatgctccgatccaggacctcatcgatcgcatgctgttcatcgag
gcgatcgagacgcagaagtgcttcgacgagaacgtcctgatcaccacggcggacgccaac
atcggctccatcatgggcatcggattcccggcctggaccggtggcgttcaccagttcatc
gtcggatacgagggcggcacggccggcttcgtcgctcgcgcaaaggaactcgctgcgcag
tacggcccgcggttcaccccgccggcttcgctaggggcatag

DBGET integrated database retrieval system