KEGG   Rhodococcus erythropolis PR4: RER_07380Help
Entry
RER_07380         CDS       T00881                                 

Definition
putative 3-ketosteroid delta(4)(5alpha)-dehydrogenase (EC:1.3.99.-)
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RER_07380
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     RER_07380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
821784..823382
Genome map
AA seq 532 aa AA seqDB search
MTWDTSVDVLVVGFGVAGASAALEAVAAGSSVLAIDRALGGGASTISGGIYYAGGGTVIQ
KEAGVEDSPEAMLAYLNREVGDAVTPQTLRRFVDESPASIDWLRSHGVPFEASLCPYKTS
YPSNKHYLYFSGSESAGGFRDIAKPAPRGHRAKGRGTSGKMLYGPLAKSAEAKGVQLLGQ
TRADRLIIEDGRVIGVEVLTLRDAPAGVRRRHATLGSLSSKPGVYAPQLRTILDALIAKI
EKKHAKRIRIQARGGVILSAGGFVSNREMMRTHAPAYKGGIPLGTSGDDGKGINLGIEAG
GTTDKLGNVSAWRFIVPPSAFLGSILVGESGARIVDESRYGAALGQAMAEKSNGIGWLLA
DSELVREAKSQISDQSMWFQRVQTTGMMRTAVRGNTIAEVARKAGIDVAGLQATVDAHNS
AAAAGQPDPMGKPSDFVRPILSAPFTMYDVSIKPNMMNPCPMLTLGGLVVDESSGMVKNE
AGEGIPGLYAAGRTAVGICSNSYVSGLSLADCVFSGRRAGQHAAAFSTVGKA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtgacctgggatacttcggttgacgtccttgtggtcgggttcggtgtggcgggcgccagt
gcggcgctcgaagcggtagcggccggttcgtcggttttggcgatcgaccgagcactcggt
ggtggggccagcactatttccggaggaatttactacgccggcggcggcaccgtgattcaa
aaggaagccggtgtcgaggacagtcccgaagccatgctcgcctacctgaaccgcgaggtc
ggtgacgcggtgacgccgcagactctgcgccggttcgtcgacgagagcccggcgtcgatc
gactggctgcgcagtcacggcgtgccgttcgaggcgtcactctgtccgtacaagacgtcg
tacccgagcaacaagcactacctctacttctcgggtagcgaatctgccggcgggttccgt
gacatcgcaaaacctgctcctcgcggccatcgcgccaaggggcgtggcacgtcgggaaag
atgctctacggcccgctcgcgaagtccgcggaggccaagggcgtccagttgctcggccag
acgagagcggaccggctgatcatcgaggacggccgggtgatcggcgtcgaagtactgacg
cttcgtgacgcacctgccggagttcgtcggcgtcacgcgacgctcggatctctgtcctcc
aagcccggcgtctacgcaccgcagttgcgcacgattctcgacgcactcatcgcgaagatc
gagaagaagcacgccaagcggattcgcatccaggcgcgcggcggcgtgatcctcagcgcc
ggcggcttcgtgtccaatcgcgagatgatgcgcacccatgcccccgcctacaagggcggt
atcccgctcggcacctccggggacgacggcaaaggcatcaacctcggtatcgaagccggg
ggaaccaccgacaagctcggcaatgtttccgcctggcgattcatcgtcccgccgagtgct
tttctcggttccatcctggtgggtgagtccggtgcgcgaatcgtcgacgagtcacgttac
ggtgccgctctcggtcaggcgatggcagagaagagcaacggaatcggttggctgctggca
gattccgaactcgttcgcgaagcgaaatcgcagatcagtgaccagtcgatgtggttccag
cgggtacagaccaccggcatgatgcgtaccgcagtgcgtggcaacaccattgccgaggtc
gcccgtaaagcggggatagacgtcgccggccttcaagccaccgtcgacgcgcacaactcc
gctgccgctgccggacaacctgatccgatgggcaaaccgtcggacttcgtcaggccgata
ctgtctgcgccgttcacgatgtacgacgtctcgatcaagcccaacatgatgaatccgtgc
ccgatgctcacgctcggtggattggtggtcgacgaatcgtccggcatggtgaaaaacgag
gccggggagggtatccctggcctgtatgccgccggccgtaccgccgtcggtatctgttcc
aactcgtatgtgagcggcttgtcgctcgccgactgcgtgttctccggacgacgagccggt
cagcatgcagccgcattctccacagtcggaaaggcctga

DBGET integrated database retrieval system