KEGG   Rhodococcus erythropolis PR4: RER_07400Help
Entry
RER_07400         CDS       T00881                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00360  Phenylalanine metabolism
rer00362  Benzoate degradation
rer00620  Pyruvate metabolism
rer00621  Dioxin degradation
rer00622  Xylene degradation
rer00650  Butanoate metabolism
rer01100  Metabolic pathways
rer01120  Microbial metabolism in diverse environments
rer01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RER_07400
   00650 Butanoate metabolism
    RER_07400
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RER_07400
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RER_07400
   00622 Xylene degradation
    RER_07400
   00621 Dioxin degradation
    RER_07400
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RER_07400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DUF4620
Motif
Other DBs
NCBI-ProteinID: BAH31448
NITE: RER_07400
UniProt: C0ZPX0
Position
824180..825082
Genome map
AA seq 300 aa AA seqDB search
MTKASVAIVGSGNISTDLLYKLQRSEWLEPRWMIGIDPESEGLARARKMGLETSAEGVDW
LLSQAEKPDLVFEATSAYVHREAAPRYEAAGIRAIDLTPAAVGPAVVPPANLREHLDAPN
VNMITCGGQATIPIVYAVSRVVDVAYAEIVASVASLSAGPGTRANIDEFTKTTSRGIETI
GGAQRGKAIIILNPADPPMIMRDTIFCAIPEDADQAAITDSIHRVVKDIQQYVPGYRLLN
EPQFDKPSVVSGGYATVTTFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAQKLLSVKA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcaagtgtggcgatcgtcggatcgggaaacatcagtaccgatctgttgtac
aaactgcagcgttccgagtggctcgaaccgcgatggatgatcggaatcgatcccgagagt
gaaggattggcgcgcgcccgcaagatgggactcgagacctccgccgagggcgtcgactgg
ttgctcagccaggcggagaaaccggacctggtcttcgaggcgacgtcggcatacgtgcac
cgcgaggcagcaccacgctacgaggccgccggtatccgtgccatcgacctgactccggcc
gcggtcggcccggctgtggttccgcccgcgaacctgcgtgaacacctggacgcacccaac
gtcaacatgatcacctgcggtgggcaggcaaccattccgatcgtctacgcggtatcgcgt
gtcgtcgacgtggcgtacgccgagatcgtcgcctccgttgcatcgttgtccgccggcccg
ggaactcgcgcgaacatcgacgagttcaccaagaccaccagccgcggtatcgagaccatc
ggcggcgcacagcgcggcaaggcgatcatcatcctcaaccccgcggacccgccgatgatc
atgcgcgacaccatcttctgcgctatccccgaagacgccgatcaggccgcgatcaccgac
tccattcaccgcgtcgtcaaggacatccagcagtacgtgcccggctaccggttgctcaac
gaaccgcagttcgacaaaccgagcgtcgtttccggtggctatgcaacggtcaccacgttc
gtcgaggtcgaaggcgcaggcgatttcctgccgccgtacgcgggcaacctcgacatcatg
acggcagcagccaccaaggtgggcgaggaaatcgcccagaagcttctgagtgtgaaggca
tga

DBGET integrated database retrieval system