KEGG   Rhodococcus erythropolis PR4: RER_08370Help
Entry
RER_08370         CDS       T00881                                 

Definition
putative hydroxyacid oxidoreductase
Orthology
K00020  
3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:rer00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
925444..926370
Genome map
AA seq 308 aa AA seqDB search
MKVGFIGLGGMGSGMAHNLLKAGYDLIVFDLDRDRGTEFVDAGATWAESIADLGRSVDIV
FTSLPGPVQMKEVGLGENGLISTLHRGAVWYDLTTNSPTVVREVDVACRAAGIELFDAPV
SGGPKGAKSGKLAIYIGGDKDSFEQHGSILDAIGDKVLYVGEVGAGNVAKLVHNCASITI
RAAIAEVMTMGVKAGVEPESLWHAMRQGAIGRARTFDRIGDRYLQGAYEPASFALALADK
DLRLSLELAEEHDVPMRLAELAQADFKEALSRGWGGRDSQSPMELQNERAGVTIKLSADE
VQSVLDRG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagggttcatcggcctcggaggtatggggtcagggatggcgcacaacctcctg
aaggcgggctacgacctgatcgtcttcgatctcgatcgtgaccgtggaacagagttcgtc
gacgccggcgcaacgtgggcggagtcgatcgcggacctcggtaggtcggtcgacatcgtc
ttcacctccctccctggcccggtccagatgaaagaggtcgggctgggcgagaacggtttg
atcagcacgctgcaccgcggggccgtctggtacgacctgaccaccaactccccgacggtc
gtccgagaggtcgacgtcgcatgccgcgcggccgggatcgaactcttcgatgcaccggtc
agtggcggacccaaaggggccaagtcgggcaagctcgccatctacatcggcggtgacaag
gattcgttcgaacagcacggcagcatcctcgatgccatcggagacaaggtcctgtacgtc
ggagaggtcggagccggcaacgtggccaagctcgtccacaactgcgccagcatcaccatc
cgggcggccatcgccgaggtcatgacaatgggtgtgaaagccggggtcgagcccgagtcg
ctctggcacgcgatgcgtcaaggtgccatcggacgcgcgcgcacgttcgaccgcatcggt
gatcggtacctgcagggcgcgtacgaaccggcttccttcgctttggcgttggcggacaaa
gatcttcggctctcgctcgagttggccgaagagcacgacgttccgatgcgactcgccgaa
ctcgcgcaggcggacttcaaggaagcgctttcgcgcggatggggaggacgcgattcgcag
tctccgatggagctccagaacgaacgcgccggcgtcaccatcaagctgtctgccgacgag
gtccagagtgtcctcgaccgcggctga

DBGET integrated database retrieval system