KEGG   Rhodococcus erythropolis PR4: RER_08370Help
Entry
RER_08370         CDS       T00881                                 

Definition
putative hydroxyacid oxidoreductase
Orthology
K00020  
3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RER_08370
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     RER_08370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
925444..926370
Genome map
AA seq 308 aa AA seqDB search
MKVGFIGLGGMGSGMAHNLLKAGYDLIVFDLDRDRGTEFVDAGATWAESIADLGRSVDIV
FTSLPGPVQMKEVGLGENGLISTLHRGAVWYDLTTNSPTVVREVDVACRAAGIELFDAPV
SGGPKGAKSGKLAIYIGGDKDSFEQHGSILDAIGDKVLYVGEVGAGNVAKLVHNCASITI
RAAIAEVMTMGVKAGVEPESLWHAMRQGAIGRARTFDRIGDRYLQGAYEPASFALALADK
DLRLSLELAEEHDVPMRLAELAQADFKEALSRGWGGRDSQSPMELQNERAGVTIKLSADE
VQSVLDRG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagggttcatcggcctcggaggtatggggtcagggatggcgcacaacctcctg
aaggcgggctacgacctgatcgtcttcgatctcgatcgtgaccgtggaacagagttcgtc
gacgccggcgcaacgtgggcggagtcgatcgcggacctcggtaggtcggtcgacatcgtc
ttcacctccctccctggcccggtccagatgaaagaggtcgggctgggcgagaacggtttg
atcagcacgctgcaccgcggggccgtctggtacgacctgaccaccaactccccgacggtc
gtccgagaggtcgacgtcgcatgccgcgcggccgggatcgaactcttcgatgcaccggtc
agtggcggacccaaaggggccaagtcgggcaagctcgccatctacatcggcggtgacaag
gattcgttcgaacagcacggcagcatcctcgatgccatcggagacaaggtcctgtacgtc
ggagaggtcggagccggcaacgtggccaagctcgtccacaactgcgccagcatcaccatc
cgggcggccatcgccgaggtcatgacaatgggtgtgaaagccggggtcgagcccgagtcg
ctctggcacgcgatgcgtcaaggtgccatcggacgcgcgcgcacgttcgaccgcatcggt
gatcggtacctgcagggcgcgtacgaaccggcttccttcgctttggcgttggcggacaaa
gatcttcggctctcgctcgagttggccgaagagcacgacgttccgatgcgactcgccgaa
ctcgcgcaggcggacttcaaggaagcgctttcgcgcggatggggaggacgcgattcgcag
tctccgatggagctccagaacgaacgcgccggcgtcaccatcaagctgtctgccgacgag
gtccagagtgtcctcgaccgcggctga

DBGET integrated database retrieval system