KEGG   Rhodococcus erythropolis PR4: RER_08590Help
Entry
RER_08590         CDS       T00881                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rer00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RER_08590 (recD)
Enzymes [BR:rer01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     RER_08590 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
952126..953994
Genome map
AA seq 622 aa AA seqDB search
MTEAQLAQRAKGIVRIFNEAGVLVAADVHVAMRVCSLGGETSEEVMLAAALAVRAVRSGS
VCLDLRRMRDVSVDNATEDELTSLPWPEPSEIVAALRLSPLVIGGNAGPLRPLRLVDTDD
GELLYLDRYFLQEQTIRRVLDERASTWPPADLKAVRTRLDSLFVDENGPTTAPDRQRIAA
ALAATQWTTVIAGGPGTGKTHTVARILALLSEELGSKARIGLAAPTGKAAARLQESVREQ
TASLGLPEELAAMTLHRLLGWQRGSSSRFKYNATNRLPYDVVVVDETSMVSLTLMARLLE
AVRPDARLLLVGDPDQLTSVDAGAVLADLVARPVEVSGNPALTQLVGDDLTATGSEEALS
ADEQDRLRGGIIQLSRGRRFDGTIASLARAVRAGDSAEVLRILRSGDPAVSFHSPEDVDA
LRADIVASSEVVTRSAEEGDAIGALKGLESHRLLCAHRDGPYGVGRWAQQAMEWVGTASG
QFLDPTRWYPGQPLLVTANDYEAKIYNGDAGVIVQREDGVPIAAFQRGSDAFLIHPSQLS
SVQTVYAMTIHRSQGSQYDTVSVMLPAEASSLLTRELLYTAITRARNHVRVIGTEDSVRA
GVQRQVLRASGLRREIRPYDGP
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgcaattggcgcagcgcgccaaagggatcgtgcgaatcttcaacgaagcc
ggggttctggttgccgccgacgttcatgtcgcgatgagagtgtgcagcctgggcggtgaa
acttccgaagaagtgatgctggccgcggcgttggcagttcgggccgtgcgatcaggttcg
gtgtgcctcgatctacgacggatgcgtgatgtgagcgtcgacaatgcgacggaagacgaa
ctcacgtcgttgccgtggcccgaaccgtcggagatcgttgccgcccttcgcctgagccct
ctggtgatcggcggcaacgccggaccgctcaggcccctccggttggtcgacacggacgac
ggtgagcttctctacctcgatcggtactttctgcaggagcagacgattcggcgagtgctc
gacgagcgtgcgtccacgtggccgcccgccgacctgaaagcggtccgaacgcgcctggat
tcgctgttcgtcgacgagaacgggccgaccaccgcccctgatcgtcaacggatagccgct
gctctcgccgcgacacagtggacgacggtcatcgccggtgggcccggaaccggcaaaacc
catacggtcgcacgtattctcgctctcctgtcggaggaactgggttcgaaggctcgcatc
gggctggccgcaccgacgggcaaagccgcagcacgtctgcaagagtccgtacgtgagcag
accgcgagccttggccttcccgaagaactagcggccatgaccctgcaccggctactcggt
tggcagcgggggagttcgagccgtttcaaatacaatgcgaccaacagacttccatacgac
gtggtcgtcgtcgacgagacgtcgatggtctccctcaccttgatggcgcgcctgctcgaa
gcggttcgccccgatgcccgtctgctgctcgtcggcgatcccgatcagttgacctcagtc
gacgccggcgctgttcttgctgaccttgtcgcccgcccggtagaagtcagtggaaatccg
gcgctgacacagttggtgggtgacgatctcacggccactggttccgaagaggcgctgagt
gcggatgagcaggatcgtctgcggggcgggatcattcaactctcacgtgggcgccgcttc
gacggaaccatcgcgtcgttggccagggcagttcgagcgggagattccgctgaggttctg
cgtatcctgcgtagtggcgatcccgccgtctccttccattctcccgaggatgttgacgca
ttgcgcgccgatatcgttgcgagttcagaggtggtgacgaggtcggccgaggagggtgat
gcgatcggcgccctgaaaggcctggaatcgcaccgccttctgtgcgcgcaccgtgacgga
ccgtacggtgtcgggcggtgggcgcagcaggcgatggagtgggtcggcacggcatcaggg
caattcctggatccgacgaggtggtatccgggccaacccctgttggtgacggccaacgac
tacgaggctaagatctacaacggggatgccggggtgatcgtgcagcgtgaggatggcgtt
cctattgctgcattccagcgggggagtgatgcgtttctgattcacccgagccaactctcg
tcggtgcagaccgtttacgcgatgacgattcaccggagccagggcagccagtacgacacg
gtatcggtgatgctgccggccgaggcttcgtcactgctcacccgggagttgttgtacacg
gcgatcactcgcgccagaaaccatgtgagggtaatcggcaccgaggattccgtgagggcg
ggagttcagcgacaggtgctcagggcaagtgggctgcgtcgggagatccgtccgtacgac
gggccgtga

DBGET integrated database retrieval system