KEGG   Rhodococcus erythropolis PR4: RER_08690Help
Entry
RER_08690         CDS       T00881                                 

Definition
putative tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_08690
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_08690
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RER_08690
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RER_08690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(964290..965531)
Genome map
AA seq 413 aa AA seqDB search
MPTHWYNLAADLPEPVPPHLHPGTREPLGPEDLAPLFPMNLIAQEVATERYIEIPETVRE
IYGMWRPSPLFRAHRLERALGTPARIYYKYEGVSPVGSHKPNTAVAQAYYNAIEGTTKLT
TETGAGQWGASLSFAGALLGLDVEVWQVRSSFDSKPYRRIQMEAYGGICHPSPSDLTEAG
RALLKSHPDTTGSLGMAISEAVEVAAQDPNTHYSLGSVLNHVMLHQTVIGQEAMVQLEEA
GDAVPDTVFGCAGGGSNLAGLAFPFLGRNLREGTKTRLVACEPSACPSLTQGEYRYDFGD
VAGLTPLLKMHTLGKDFVPPAIHAGGLRYHGMSPMVSHAVNLGLMDAIAVDQDDALQAGL
IFARAEGIIPAPESTHAVAGAIAHARAVTEPEVIVIGLSGNGQLDLPAYSPYV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacgcactggtacaacctggcggctgacctccccgagcctgttcccccgcacctg
catccgggcactcgtgagccgctcggccccgaggacttggcgccgctgttcccgatgaac
ctcatcgcgcaggaagtcgcaacggagcgctacatcgagatcccggagacggttcgcgag
atctacggcatgtggaggccctctcccctgttccgcgcgcatcgactcgagcgcgctctc
ggcacacctgcccgcatctactacaagtacgaaggcgtgagcccggtcggttcacacaag
ccgaatactgctgtcgcgcaggcttactacaacgcaatcgagggaaccaccaagctcacc
accgaaaccggtgcgggacagtggggtgcgtcgctgtcgttcgcgggcgcgctgctcgga
ctcgacgtcgaggtatggcaggttcgctcgtccttcgattcgaagccgtaccgacgcatc
cagatggaggcgtacggcggaatctgtcacccgtcgccttcggacctgacggaagccgga
cgcgcactgttgaagtcgcatcccgacaccaccggctcgctcggtatggccatcagtgag
gccgtcgaggtcgctgcgcaggatccgaacacgcactactcactcggtagcgtgctgaac
cacgtcatgctgcaccagaccgtgatcggtcaggaagcaatggtccagctcgaagaagcc
ggcgacgccgtccccgacaccgtgttcggttgcgccggtggcggttccaacctcgccgga
ctcgccttcccgttcctgggacgaaaccttcgcgaaggcaccaagactcgtctggtcgcc
tgcgagccgtcggcatgcccgtccctcacccagggcgagtaccgctacgacttcggtgat
gtcgccggcctgacgccgctgctcaagatgcacactctgggtaaggatttcgtaccgccg
gccatccatgccggtggcctccgctaccacggcatgtcgccgatggtctcgcacgcggtc
aacctcggactcatggatgcaattgccgtcgatcaggacgacgcactccaggcaggtctg
attttcgcccgcgccgaaggaatcatcccggctccggaatcaacccacgcggttgccggc
gctatcgctcacgcccgtgccgtcaccgaacccgaggtgatcgtgatcgggctgtccggc
aacggtcagttggatcttccggcgtactcgccttacgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system