KEGG   Rhodococcus erythropolis PR4: RER_08690Help
Entry
RER_08690         CDS       T00881                                 

Definition
(GenBank) putative tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RER_08690
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_08690
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RER_08690
Enzymes [BR:rer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RER_08690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(964290..965531)
Genome map
AA seq 413 aa AA seqDB search
MPTHWYNLAADLPEPVPPHLHPGTREPLGPEDLAPLFPMNLIAQEVATERYIEIPETVRE
IYGMWRPSPLFRAHRLERALGTPARIYYKYEGVSPVGSHKPNTAVAQAYYNAIEGTTKLT
TETGAGQWGASLSFAGALLGLDVEVWQVRSSFDSKPYRRIQMEAYGGICHPSPSDLTEAG
RALLKSHPDTTGSLGMAISEAVEVAAQDPNTHYSLGSVLNHVMLHQTVIGQEAMVQLEEA
GDAVPDTVFGCAGGGSNLAGLAFPFLGRNLREGTKTRLVACEPSACPSLTQGEYRYDFGD
VAGLTPLLKMHTLGKDFVPPAIHAGGLRYHGMSPMVSHAVNLGLMDAIAVDQDDALQAGL
IFARAEGIIPAPESTHAVAGAIAHARAVTEPEVIVIGLSGNGQLDLPAYSPYV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgccgacgcactggtacaacctggcggctgacctccccgagcctgttcccccgcacctg
catccgggcactcgtgagccgctcggccccgaggacttggcgccgctgttcccgatgaac
ctcatcgcgcaggaagtcgcaacggagcgctacatcgagatcccggagacggttcgcgag
atctacggcatgtggaggccctctcccctgttccgcgcgcatcgactcgagcgcgctctc
ggcacacctgcccgcatctactacaagtacgaaggcgtgagcccggtcggttcacacaag
ccgaatactgctgtcgcgcaggcttactacaacgcaatcgagggaaccaccaagctcacc
accgaaaccggtgcgggacagtggggtgcgtcgctgtcgttcgcgggcgcgctgctcgga
ctcgacgtcgaggtatggcaggttcgctcgtccttcgattcgaagccgtaccgacgcatc
cagatggaggcgtacggcggaatctgtcacccgtcgccttcggacctgacggaagccgga
cgcgcactgttgaagtcgcatcccgacaccaccggctcgctcggtatggccatcagtgag
gccgtcgaggtcgctgcgcaggatccgaacacgcactactcactcggtagcgtgctgaac
cacgtcatgctgcaccagaccgtgatcggtcaggaagcaatggtccagctcgaagaagcc
ggcgacgccgtccccgacaccgtgttcggttgcgccggtggcggttccaacctcgccgga
ctcgccttcccgttcctgggacgaaaccttcgcgaaggcaccaagactcgtctggtcgcc
tgcgagccgtcggcatgcccgtccctcacccagggcgagtaccgctacgacttcggtgat
gtcgccggcctgacgccgctgctcaagatgcacactctgggtaaggatttcgtaccgccg
gccatccatgccggtggcctccgctaccacggcatgtcgccgatggtctcgcacgcggtc
aacctcggactcatggatgcaattgccgtcgatcaggacgacgcactccaggcaggtctg
attttcgcccgcgccgaaggaatcatcccggctccggaatcaacccacgcggttgccggc
gctatcgctcacgcccgtgccgtcaccgaacccgaggtgatcgtgatcgggctgtccggc
aacggtcagttggatcttccggcgtactcgccttacgtctga

DBGET integrated database retrieval system