KEGG   Rhodococcus erythropolis PR4: RER_08960Help
Entry
RER_08960         CDS       T00881                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RER_08960
  Amino acid metabolism
   00380 Tryptophan metabolism
    RER_08960
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RER_08960
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RER_08960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(989191..990591)
Genome map
AA seq 466 aa AA seqDB search
MSVDTTPEATTDARIPHPAWRLPVLGDVLGINIRTPLQNSVSIGRELGPIFERNVLGNRF
VFASGADMVAELSDESRFAKHLAPGVKALRGIGGDGLFTAYNHEPNWGKAHNLLAPAFSQ
TAMRSYHRTMLDVAGELVDHWDSRDSDSPIDVSADMTKLTLETIGRTGFSYSFDSFEREE
QHPFVKAMVGALSHSQRTTFLKSTALGRVLARRADQRDEVRKAYMAEVVDEVIRARRTST
EPGPEDLLELMLRAARENDPNRIDELNIRHQVVTFLVAGHETTSGALSFALYYLSRNPDV
LAKAQAEVDKVWEGEEPAFEKIAKLRYVRRVLDESLRLWPTAPAYGRAALEDTTLVGKYP
MKKGDWMLVLIPSLHRDPVWGNDPEAFDPDRFLPANIKARPAHVYKPFGTGERACIGRQF
AIHEAVLVLGTILQKYTIEADPDYELKVAERLTLMPEGFNLTVRRR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgacaccactccagaggcgacgaccgatgctcggattccgcatccggcatgg
cgcctgccagtcctcggggacgtcctcgggatcaatatccggacgccgctgcagaactcc
gtgagcatcgggcgcgaactcggcccgatcttcgagagaaatgtcctgggaaatcgcttc
gtcttcgcctcgggcgcggacatggtggcagaactgtccgacgagtcccggttcgcgaag
caccttgcgcctggagtcaaagcactccgcggaatcggcggcgacggactgttcactgcg
tacaaccacgaacccaactggggcaaggcgcacaatctcctggccccggcgttcagccag
actgcgatgcgctcgtaccaccgcaccatgctcgacgtggccggcgagctggtcgatcat
tgggacagtcgtgacagcgactcccccatcgacgtctcggcagacatgaccaagctgacg
ttggagaccatcggacgcactggattcagctactcgttcgactctttcgaacgtgaagag
cagcacccgttcgtcaaggcgatggtcggcgctctctcccattcacaacgcacgacgttc
ttgaagtcgacggccctggggcgagtcctcgcacgtcgggccgatcaacgtgacgaggtc
cgcaaggcgtacatggccgaggttgtggacgaggtgatccgtgcccggcggacaagtacc
gaaccggggccggaagatcttctcgaactgatgctgcgggcggcacgcgaaaacgatccc
aaccgtatcgacgaactgaacatccgccatcaggtcgtgaccttcctcgtcgcgggacac
gaaaccacctccggcgcgctgtcgttcgcgctgtactacctgtcacgaaaccctgacgtg
ctggccaaggcgcaagccgaggtcgacaaggtctgggagggcgaggagcccgccttcgag
aagatcgcgaaacttcgatacgtacgacgcgtcctcgacgaatcgctgcgtctgtggccg
accgctcccgcctacggccgtgcggcgctcgaagacaccacgctcgtcggcaagtatccg
atgaagaagggcgattggatgctcgtgctcatcccgtcacttcatcgcgatcccgtgtgg
ggcaacgatcccgaggctttcgatccggatcgcttcctacctgccaacatcaaggccagg
ccggcgcacgtgtacaagccgttcggaacaggtgaacgcgcctgcatcggaagacaattc
gccattcacgaagcggtcctcgtgttgggcaccatcttgcagaagtatacgatcgaagcc
gatccggactacgagttgaaggtggccgaacggctcaccctgatgcccgaaggcttcaac
ttgacggtccgccgacgctga

DBGET integrated database retrieval system