KEGG   Rhodococcus erythropolis PR4: RER_08960Help
Entry
RER_08960         CDS       T00881                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:rer00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:rer00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rer00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(989191..990591)
Genome map
AA seq 466 aa AA seqDB search
MSVDTTPEATTDARIPHPAWRLPVLGDVLGINIRTPLQNSVSIGRELGPIFERNVLGNRF
VFASGADMVAELSDESRFAKHLAPGVKALRGIGGDGLFTAYNHEPNWGKAHNLLAPAFSQ
TAMRSYHRTMLDVAGELVDHWDSRDSDSPIDVSADMTKLTLETIGRTGFSYSFDSFEREE
QHPFVKAMVGALSHSQRTTFLKSTALGRVLARRADQRDEVRKAYMAEVVDEVIRARRTST
EPGPEDLLELMLRAARENDPNRIDELNIRHQVVTFLVAGHETTSGALSFALYYLSRNPDV
LAKAQAEVDKVWEGEEPAFEKIAKLRYVRRVLDESLRLWPTAPAYGRAALEDTTLVGKYP
MKKGDWMLVLIPSLHRDPVWGNDPEAFDPDRFLPANIKARPAHVYKPFGTGERACIGRQF
AIHEAVLVLGTILQKYTIEADPDYELKVAERLTLMPEGFNLTVRRR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgacaccactccagaggcgacgaccgatgctcggattccgcatccggcatgg
cgcctgccagtcctcggggacgtcctcgggatcaatatccggacgccgctgcagaactcc
gtgagcatcgggcgcgaactcggcccgatcttcgagagaaatgtcctgggaaatcgcttc
gtcttcgcctcgggcgcggacatggtggcagaactgtccgacgagtcccggttcgcgaag
caccttgcgcctggagtcaaagcactccgcggaatcggcggcgacggactgttcactgcg
tacaaccacgaacccaactggggcaaggcgcacaatctcctggccccggcgttcagccag
actgcgatgcgctcgtaccaccgcaccatgctcgacgtggccggcgagctggtcgatcat
tgggacagtcgtgacagcgactcccccatcgacgtctcggcagacatgaccaagctgacg
ttggagaccatcggacgcactggattcagctactcgttcgactctttcgaacgtgaagag
cagcacccgttcgtcaaggcgatggtcggcgctctctcccattcacaacgcacgacgttc
ttgaagtcgacggccctggggcgagtcctcgcacgtcgggccgatcaacgtgacgaggtc
cgcaaggcgtacatggccgaggttgtggacgaggtgatccgtgcccggcggacaagtacc
gaaccggggccggaagatcttctcgaactgatgctgcgggcggcacgcgaaaacgatccc
aaccgtatcgacgaactgaacatccgccatcaggtcgtgaccttcctcgtcgcgggacac
gaaaccacctccggcgcgctgtcgttcgcgctgtactacctgtcacgaaaccctgacgtg
ctggccaaggcgcaagccgaggtcgacaaggtctgggagggcgaggagcccgccttcgag
aagatcgcgaaacttcgatacgtacgacgcgtcctcgacgaatcgctgcgtctgtggccg
accgctcccgcctacggccgtgcggcgctcgaagacaccacgctcgtcggcaagtatccg
atgaagaagggcgattggatgctcgtgctcatcccgtcacttcatcgcgatcccgtgtgg
ggcaacgatcccgaggctttcgatccggatcgcttcctacctgccaacatcaaggccagg
ccggcgcacgtgtacaagccgttcggaacaggtgaacgcgcctgcatcggaagacaattc
gccattcacgaagcggtcctcgtgttgggcaccatcttgcagaagtatacgatcgaagcc
gatccggactacgagttgaaggtggccgaacggctcaccctgatgcccgaaggcttcaac
ttgacggtccgccgacgctga

DBGET integrated database retrieval system