KEGG   Rhodococcus erythropolis PR4: RER_09480Help
Entry
RER_09480         CDS       T00881                                 

Definition
putative sugar kinase (EC:2.7.1.-)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_09480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_09480
   00052 Galactose metabolism
    RER_09480
   00500 Starch and sucrose metabolism
    RER_09480
   00520 Amino sugar and nucleotide sugar metabolism
    RER_09480
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RER_09480
   00524 Butirosin and neomycin biosynthesis
    RER_09480
Enzymes [BR:rer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RER_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1043241..1044170
Genome map
AA seq 309 aa AA seqDB search
MTSGQKRWIGIDIGGTKVAAAVATSDGDVIDTVRAATPTAGREAVLETATALVDRLRADH
PVAGIGVGAPGIIDRVRGRVVFASDILSGWSGAEVRGELEAHSGLPVTVDNDVRAMAHGE
NMIGAGRGRSSALFVSIGTGIGGALTVGGQLYHGAHGTAGELAHLLVPVSGAIGCGCGRT
DHLEAVASGPAMAAEYAARAGVPTQPLQKVVALMRSGDPIARAVVTDAGTLLGRVLAGVA
TAFDPEVIVIGGGAAQIGADLLSPLTSAFRVEAMGPIAETAILPARLGTDAPLVGAALLA
AATRIEVTP
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgggcagaagcgatggatcggcatcgacatcggcggcaccaaagtggctgct
gcggtggcgacgtccgacggagacgtgatcgacacggttcgtgcggcaacaccgacggcc
ggtagggaggctgttctcgagaccgccaccgcgttggtcgaccgtttgagggcggatcac
ccggtagccggaatcggagtcggtgcaccgggaatcatcgatcgggtgcgtggccgcgtc
gtcttcgcctccgacattctgtccggatggagtggcgccgaggttcgcggggaactcgag
gcgcactcgggtctaccggtgacggtggacaacgacgtgcgcgcgatggcccacggcgag
aacatgatcggcgccggtcgcggtcgaagctctgcactgttcgtctcgatcggtactgga
atcggtggcgcgttgaccgtgggcggacagctgtatcacggcgcccacggaacagccggc
gagctcgcgcatctgctggttccggtctccggggcgataggttgcggttgcggtagaacc
gatcacctcgaggcagtcgcctctggcccggcgatggcggccgagtacgcagcgcgggcg
ggtgtgcccactcaaccgttgcagaaggtggtggcactcatgcgctccggcgacccgatc
gcccgtgccgtggtcaccgacgccggtactctgctcggccgagtcctggccggcgtcgcc
accgcattcgatcccgaggtgatcgtcatcggcggcggcgcagcccagatcggagccgac
ctcttgtcgccgctgacgtccgctttccgggtggaagcgatgggtcccattgccgaaacc
gccattcttcctgcccgtttgggcaccgatgcgccgctcgtcggagctgcgctcctggcc
gccgcaacacgaatcgaggtaacaccgtga

DBGET integrated database retrieval system