KEGG   Rhodococcus erythropolis PR4: RER_10120Help
Entry
RER_10120         CDS       T00881                                 

Gene name
choE
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RER_10120 (choE)
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     RER_10120 (choE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1127883..1129541
Genome map
AA seq 552 aa AA seqDB search
MSIRAGSNERHARTNSTLSRRNFLAATGLAVGAAALSSSWTTAAAAPRRALSDGDRVPAL
VIGSGYGGAVAALRLTQAGIDTHMVEMGKSWTTPGSDGKVFCPMLSPDGRSFWLRDRTVQ
PVSHFSGGSVDKNISRYVGVLDAEDFGGIKVYQGRGVGGGSLVNGGMAVTPKRNYFEEIL
PGVDSNEMYSTYFPRANAALGVNNIDPAWFESTEYYKFARTGRKTAERSGYTTTFVPNVY
DFNYMKQEAAGQVTKSALVSEVIYGNNAGKKSLDKTYLAAASATGKLTISALHVVTSVAP
AATGGGYQVVMNQINEQGNTVGTKTVTADKVFFAAGSIGTSKLLVAMKAQGQLANLPGAV
GQEWGHNGNVMVGRANHMWDATGAKQSAIPVMGIDNWADTSAPVFAEIAPFPAGTELWVS
LYLAIAKNPQRAQFQFNSATGKVGLNWQRSQNQPSIDMAKKLFDKINKKEGTIYRTDLFG
PVQTWGDQLTYHPLGGCVLGKATDGYGRLPEYPGLYVMDGSLVPGNVGVNPFVTITALAE
RNIENIIANDMN
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
ttgagcattcgcgctggatccaacgaacggcacgcacgtaccaattccacgctctcgcgt
agaaacttcttggcagcaacaggattagctgtgggcgccgctgcgctctcgtcctcgtgg
actacggccgccgctgcgcccaggcgagcattgagcgacggagaccgtgtccctgcgctc
gtgatcggcagcgggtacggcggagccgttgcggcacttcggctgacgcaggccggcatc
gacacacacatggtcgagatggggaagtcgtggaccacaccggggtccgacggcaaggtc
ttctgcccgatgctctcacctgacggacgttccttctggctcagagaccgtacagttcaa
ccggtttcgcacttctccggcggctcggtggacaagaacatcagccgctacgtcggcgtt
ctcgacgccgaggacttcggcgggatcaaggtctaccaaggccgaggggtcggcggcggg
tcgctggtcaacggcggcatggccgtcacacccaagcgcaactacttcgaagagatcctg
cccggggtcgattccaacgagatgtactcgacgtacttcccgcgggccaacgctgcgctc
ggagtcaacaacatcgacccggcctggttcgagtcgaccgagtactacaagtttgcacga
accgggcgaaagaccgctgagagatccggttacacaacaacattcgtgccgaatgtttac
gacttcaactacatgaagcaggaagctgctggtcaggtcaccaagtctgccctggtgagt
gaggtcatctacggcaacaacgcgggaaagaagtctctggacaagacgtacctcgctgcg
gcatccgccaccggcaagctcacgatctcggcgctgcacgtcgtgacctcggttgcgccg
gccgcgaccggtggtggatatcaagtggtgatgaaccagatcaacgagcagggcaacacc
gtcggcaccaagacggtgaccgcggacaaggtcttcttcgcggccggcagtatcggcacc
agtaagctcctggtcgcgatgaaagcacaagggcagctggcgaatttgccgggtgcggtt
gggcaggaatgggggcacaacggcaacgtgatggtgggtcgcgccaatcacatgtgggac
gccaccggcgcgaagcagtcggcgatccccgtgatgggtatcgacaactgggctgacaca
tccgctcctgtgttcgcggaaatcgcgccctttccagccggtaccgaactgtgggtcagc
ctgtacttggcgattgccaagaatccgcaacgtgctcagttccaattcaactcggcaaca
ggcaaagtcggtttgaattggcagcgctcgcagaaccagccgtcgatcgacatggcgaag
aaactcttcgacaagatcaacaaaaaggaaggcacgatctaccggaccgacctcttcggt
ccggtgcagacgtggggcgaccagttgacgtaccatcccctcggcggttgtgtgcttggc
aaggcgaccgacggctacggtcgtctgccggagtacccgggactgtatgtcatggacgga
tccctcgttccgggcaatgtcggagtcaatccgtttgtcaccatcaccgctctggccgaa
cggaacatcgagaacatcattgcgaacgacatgaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system