KEGG   Rhodococcus erythropolis PR4: RER_10420Help
Entry
RER_10420         CDS       T00881                                 

Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RER_10420
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RER_10420
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RER_10420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1165336..1165833
Genome map
AA seq 165 aa AA seqDB search
MTTPVQNIAINTLGGVPTSLGEYDGRAVLVVNVASKCGLTPQYSALEKLASEYADRGLTV
IGIPCNQFMGQEPGTAEEIETFCSTTYGVTFPLLEKIEVNGENQHPLYAELTKAADAEGA
AGDIQWNFEKFLIGPDGTVVNRFRPRTEPDAPEVVAAIEAALPKN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccagtacagaacatcgcgatcaacaccctcggtggcgtgcccacctcgttg
ggtgaatacgacggccgtgccgtgctcgtggtcaacgtggcatccaagtgtggactgacc
ccgcagtactcggcgctcgagaagctggccagcgagtacgccgatcgcggtctgaccgtg
atcggcatcccgtgcaaccagttcatggggcaggaaccgggtaccgccgaagagatcgag
acgttctgctccactacctacggcgtcacgttcccgctcctcgagaagatcgaggtgaac
ggcgagaaccagcatccgctgtacgccgaactcaccaaggctgccgacgccgaaggcgct
gcgggcgacatccagtggaacttcgagaagttcttgatcggaccggacggcaccgtcgtc
aaccgcttccgtccgcggaccgaacctgacgctcccgaggttgtcgccgccatcgaagct
gcgcttccgaagaattag

DBGET integrated database retrieval system