KEGG   Rhodococcus erythropolis PR4: RER_10470Help
Entry
RER_10470         CDS       T00881                                 

Gene name
purQ
Definition
phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rer00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1169286..1169963
Genome map
AA seq 225 aa AA seqDB search
MSARIGVITFPGTLDDIDAARAINLAGGEAVELWHGDADLKGVDAVVVPGGFSYGDYLRC
GAIARFAPAMGKVVEAAKGGMPVLGICNGFQILCEAGLLPGALTRNQGLHFICRDEWLTV
EANNTAWSSRYEAGAQILIPLKSGEGRFQASENVLDELEGEGRVVFRYSEENPNGSQRRI
AGISSANGRVVGLMPHPEHATEALTGPSDDGLGLFYSALDAIVTA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgtatcggggttatcacgttcccgggcacgctcgacgacatcgatgctgct
cgggccatcaacctggccggcggtgaagctgtcgaactctggcacggcgacgcagacctc
aagggtgtcgacgcggttgtcgttcccggcggattctcctacggcgactaccttcgttgc
ggcgcgatcgcacgttttgctcccgcgatgggcaaggttgtcgaagcagccaagggcggc
atgccggtcctgggcatctgcaacggtttccagatcctctgcgaagcaggtttgctcccc
ggtgccctgacccgtaaccagggtctgcacttcatctgccgcgacgagtggttgacggtc
gaagccaacaacacggcttggtcctcgcgttacgaggccggcgcccagatcctcatcccg
ctcaagtcgggtgaaggtcgcttccaggcttccgagaatgttctcgacgaactcgagggt
gaaggccgcgtcgtctttcgctactcggaggagaaccccaacggttcgcagcgtcgtatc
gccggtatctcttcggccaacggccgcgtcgtcggtttgatgccgcaccccgagcacgcc
accgaggctctcaccggaccgagcgacgacggactcggcttgttctactcggcactcgac
gcgatcgtcactgcctga

DBGET integrated database retrieval system