KEGG   Rhodococcus erythropolis PR4: RER_11170Help
Entry
RER_11170         CDS       T00881                                 

Definition
putative glycosidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RER_11170
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RER_11170
Enzymes [BR:rer01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RER_11170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1245259..1246437
Genome map
AA seq 392 aa AA seqDB search
MRIKFLKAATTIALCGGLVAGCSGENGTADPVSSAPTSTTSEITSTPAASSSAPVAASCG
SDLLASLSLRQKLAQLLNVGVTGTDDALSIVQNEEIGGIFVGSWTDQSMLTNREVPQVAS
ASKLPLMVTIDEEGGRVSRVADILGPDPSARETAQTMTVEQTYQMALERGRGLKDLGITV
NYAPDVDVSSQPDDSVIGDRSYSDDPQTVVAYAGAYAQGMRDAGIFPVIKHFPGHGSASG
DSHRGEVTTPPLQDLIASDLIPFRELSGTGVGVMMGHLEVPGLTEPGTPASISPAAVALL
RDGVGYGAAPFTGPVFTDDLSGMQAITDRYDIADAVQAALVAGVDQALWLTTDDVPRVLD
HLEQAVASGELPQARVDQAVVTVATAKGAVTC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcaagtttctgaaggctgcgacgaccattgctttatgcggagggttggttgcg
ggatgctcgggcgaaaacgggaccgccgatccggtttcgagcgccccgaccagcaccacc
tccgagatcacgtcgacgcctgcggcatccagctccgcgcccgtcgccgcgtcgtgcggt
agtgaccttctggcttcactgtccctgcgtcagaaacttgcccagctgctcaacgtcggc
gtcaccgggaccgatgacgcgttgtcgatagtgcagaacgaggagatcggcggcatcttc
gtcggaagttggaccgatcagtcgatgctcaccaatcgcgaagtgccgcaggttgcttcg
gcgtcgaagttgccgttgatggtgacgatcgacgaagaaggtggacgagtttcccgcgtc
gcggacatcctcgggcccgatccgtcggccagagaaacggcgcagaccatgacagtggaa
cagacgtaccagatggcgctcgagcgtggacgcgggttgaaggatctcgggatcaccgtc
aactacgcccccgacgtcgacgtcagcagccaacccgacgactccgtgatcggggaccgc
tcgtactccgacgacccccagaccgtggttgcctacgccggtgcgtacgcgcagggtatg
cgcgatgccggaatcttcccggtgatcaagcactttcccggacatggcagcgcgtcgggt
gactcgcaccggggtgaggtgacaacgccgcccttgcaggatctgatcgcgtcggacctg
attcccttccgggagctgtcgggaaccggagtcggcgtcatgatgggtcacctcgaggtt
cccggtctgaccgagcccggtacccctgccagcatcagccccgccgccgtcgcgttgctt
cgcgacggagtgggttacggcgcagcgccgttcaccggcccggtattcaccgacgacctc
agcggaatgcaggcgatcaccgaccgatacgatattgccgacgcggttcaggctgcgctg
gtggctggagtcgatcaggcattgtggctgacaaccgacgacgttccgcgggtgctcgac
catctcgagcaggccgtcgcgtccggtgagcttccgcaggcgcgggtcgatcaggccgtg
gtcacagttgccactgccaaaggtgccgtgacctgctga

DBGET integrated database retrieval system