KEGG   Rhodococcus erythropolis PR4: RER_16200Help
Entry
RER_16200         CDS       T00881                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_16200 (gpm)
   01230 Biosynthesis of amino acids
    RER_16200 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_16200 (gpm)
  Energy metabolism
   00680 Methane metabolism
    RER_16200 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_16200 (gpm)
Enzymes [BR:rer01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RER_16200 (gpm)
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RER_16200 (gpm)
  Exosomal proteins of melanoma cells
   RER_16200 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1760583..1761329
Genome map
AA seq 248 aa AA seqDB search
MSIGTLVLLRHGESEWNALNLFTGWVDVHLTDKGMAEGKRAGELLAEHNLLPDVLYTSLL
RRAISTANLALDAADRHWIPVVRDWRLNERHYGALQGKNKAQTKEEYGNEQFMLWRRSYD
TPPPAIEAGSECSQDTDPRYANLDEVPLTECLLDVVKRLIPYWEDTISQELLAGRNVLVT
AHGNSLRALVKHLDGISDEDIAGLNIPTGIPLRYDLDENLKPLNPGGTYLDPEAAAAGAA
AVANQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggaaccctggtcctgctccgccacggcgagagcgaatggaatgcactcaat
ctgttcaccggctgggtggacgtacacctgacagacaagggcatggccgagggcaagcgc
gccggcgaactgctcgccgagcacaacctgttgcccgacgttctctacacgtctctgctg
cgccgcgcgatcagcacggccaacctcgcactcgacgccgccgatcgccactggatcccg
gtagtgcgcgactggcgtctcaacgagcgccactacggcgctctgcagggcaagaacaag
gcgcagaccaaggaagagtacggaaacgagcagttcatgctctggcgtcgtagctacgac
accccgccgcccgccatcgaagccggcagcgagtgcagccaggacaccgatcctcggtac
gcgaacctcgacgaggttcccttgaccgagtgcctgctcgacgtcgtcaagcgtctgatc
ccgtactgggaggacaccatctcccaggagctgctcgccggccggaacgtgctggtcacc
gcgcacggcaactcgctgcgtgcattggtcaagcacctcgacggcatctcggacgaggac
atcgcgggcctgaacatcccgaccggaatcccgctgcgctacgacctcgacgagaacctg
aagccgctcaatcccggcggcacctatctggatccggaggccgcagctgccggcgccgcc
gcggtggcgaatcagggcggaaagtag

DBGET integrated database retrieval system