KEGG   Rhodococcus erythropolis PR4: RER_16200Help
Entry
RER_16200         CDS       T00881                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_16200 (gpm)
   01230 Biosynthesis of amino acids
    RER_16200 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RER_16200 (gpm)
  Energy metabolism
   00680 Methane metabolism
    RER_16200 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RER_16200 (gpm)
Enzymes [BR:rer01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RER_16200 (gpm)
Exosome [BR:rer04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RER_16200 (gpm)
  Exosomal proteins of melanoma cells
   RER_16200 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1760583..1761329
Genome map
AA seq 248 aa AA seqDB search
MSIGTLVLLRHGESEWNALNLFTGWVDVHLTDKGMAEGKRAGELLAEHNLLPDVLYTSLL
RRAISTANLALDAADRHWIPVVRDWRLNERHYGALQGKNKAQTKEEYGNEQFMLWRRSYD
TPPPAIEAGSECSQDTDPRYANLDEVPLTECLLDVVKRLIPYWEDTISQELLAGRNVLVT
AHGNSLRALVKHLDGISDEDIAGLNIPTGIPLRYDLDENLKPLNPGGTYLDPEAAAAGAA
AVANQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggaaccctggtcctgctccgccacggcgagagcgaatggaatgcactcaat
ctgttcaccggctgggtggacgtacacctgacagacaagggcatggccgagggcaagcgc
gccggcgaactgctcgccgagcacaacctgttgcccgacgttctctacacgtctctgctg
cgccgcgcgatcagcacggccaacctcgcactcgacgccgccgatcgccactggatcccg
gtagtgcgcgactggcgtctcaacgagcgccactacggcgctctgcagggcaagaacaag
gcgcagaccaaggaagagtacggaaacgagcagttcatgctctggcgtcgtagctacgac
accccgccgcccgccatcgaagccggcagcgagtgcagccaggacaccgatcctcggtac
gcgaacctcgacgaggttcccttgaccgagtgcctgctcgacgtcgtcaagcgtctgatc
ccgtactgggaggacaccatctcccaggagctgctcgccggccggaacgtgctggtcacc
gcgcacggcaactcgctgcgtgcattggtcaagcacctcgacggcatctcggacgaggac
atcgcgggcctgaacatcccgaccggaatcccgctgcgctacgacctcgacgagaacctg
aagccgctcaatcccggcggcacctatctggatccggaggccgcagctgccggcgccgcc
gcggtggcgaatcagggcggaaagtag

DBGET integrated database retrieval system