KEGG   Rhodococcus erythropolis PR4: RER_16520Help
Entry
RER_16520         CDS       T00881                                 

Definition
putative sugar-phosphate phosphatase (EC:3.1.3.-)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rer00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1789764..1790510
Genome map
AA seq 248 aa AA seqDB search
MTRTNDERAAIDIAAAAGELLLDHRKSLGENDGDVATFKNAADRLSHEFIVAELARRFPA
DAVLSEEGADDLARLAADRVWIVDPLDGTREYGEAGRSDWAVHVALSENGVLTTGAVAMP
ALGVTYSSSDDRTERGASTPVRVVVSRTRRPEPVMRMADSMGAKLIEMGSAGAKAMAVVS
GEADIYAHAGGQYEWDSAAPVAVARAAGLHVSRIDGSELRYNQENPWLPDLLICRPELAP
KALEELGR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcactaacgatgaacgcgcggcgatcgacatcgccgctgcggcgggagaactt
ctgctcgaccatcggaaatccctcggcgaaaacgacggtgatgtcgcgactttcaagaac
gcggccgatcggctcagtcacgaattcatcgtcgccgaacttgcccgacgctttcctgcg
gatgcagtgctgtcggaggaaggggctgacgacctcgcgaggctggctgcggatcgggtg
tggatcgtcgaccctctcgacggcacccgtgagtacggcgaggccggacgatcggactgg
gcagtgcatgttgcactgagcgaaaacggtgtcctcacaacaggtgcggtcgcgatgcct
gccctcggcgtcacctattccagcagcgatgatcgaaccgagcgcggcgcttcgacaccg
gtgcgggtcgtcgtgtcgcggacgcggcgtccggaaccggtcatgcgcatggccgactcg
atgggcgcgaagttgatcgaaatgggatccgccggagccaaagcaatggcggtcgtctcg
ggtgaggcagacatctatgcacatgcgggcggacagtacgagtgggattcggcggcgccg
gttgctgtcgcacgtgctgcgggactgcatgtttcgcgtatcgatggcagcgaactgcgc
tacaaccaggaaaacccgtggttgccggatctgctgatctgccgacccgaactcgccccg
aaagcactggaggaactgggccgatga

DBGET integrated database retrieval system