KEGG   Rhodococcus erythropolis PR4: RER_20440Help
Entry
RER_20440         CDS       T00881                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rer  Rhodococcus erythropolis PR4
Pathway
rer00020  Citrate cycle (TCA cycle)
rer00190  Oxidative phosphorylation
rer00650  Butanoate metabolism
rer01100  Metabolic pathways
rer01110  Biosynthesis of secondary metabolites
rer01120  Microbial metabolism in diverse environments
rer01130  Biosynthesis of antibiotics
rer01200  Carbon metabolism
Module
rer_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RER_20440 (sdhD)
   00650 Butanoate metabolism
    RER_20440 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RER_20440 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAH32752
NITE: RER_20440
UniProt: C0ZWL7
Position
complement(2234742..2235197)
Genome map
AA seq 151 aa AA seqDB search
MATTHGPEAKSLGTSYDRPASLDNPRSPRAKARNNFELYAWLFMRFSGVALIVLVLGHMF
IMLMLDGGVHRLNFAFVAGRWSSPFWQFWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRF
WLTTILVLSMILIMGLGTYVIFTFDPNISAS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcgactactcacggacccgaagccaagagcctgggcacctcatacgaccgtcccgca
agcctggacaacccgcggtccccgcgcgcgaaggctcggaacaacttcgagttgtacgca
tggctgttcatgcgcttctccggcgtcgccctgatcgttctggtcctgggccacatgttc
atcatgctgatgctcgacggtggcgttcaccgtctgaacttcgcattcgtcgcaggtcgc
tggtccagcccgttctggcagttctgggatctgacgatgttgtggctggcacagctgcac
ggcggtaacggcctgcgcacggtcatcgcggactactcccgcaaggactccacgcgcttc
tggctgaccacgatcctcgttctctcgatgatcctgatcatgggcctgggcacgtacgtc
atcttcaccttcgaccccaatatctcggcgagctag

DBGET integrated database retrieval system