KEGG   Rhodococcus erythropolis PR4: RER_20440Help
Entry
RER_20440         CDS       T00881                                 

Gene name
sdhD
Definition
putative succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RER_20440 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RER_20440 (sdhD)
   00650 Butanoate metabolism
    RER_20440 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RER_20440 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2234742..2235197)
Genome map
AA seq 151 aa AA seqDB search
MATTHGPEAKSLGTSYDRPASLDNPRSPRAKARNNFELYAWLFMRFSGVALIVLVLGHMF
IMLMLDGGVHRLNFAFVAGRWSSPFWQFWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRF
WLTTILVLSMILIMGLGTYVIFTFDPNISAS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggcgactactcacggacccgaagccaagagcctgggcacctcatacgaccgtcccgca
agcctggacaacccgcggtccccgcgcgcgaaggctcggaacaacttcgagttgtacgca
tggctgttcatgcgcttctccggcgtcgccctgatcgttctggtcctgggccacatgttc
atcatgctgatgctcgacggtggcgttcaccgtctgaacttcgcattcgtcgcaggtcgc
tggtccagcccgttctggcagttctgggatctgacgatgttgtggctggcacagctgcac
ggcggtaacggcctgcgcacggtcatcgcggactactcccgcaaggactccacgcgcttc
tggctgaccacgatcctcgttctctcgatgatcctgatcatgggcctgggcacgtacgtc
atcttcaccttcgaccccaatatctcggcgagctag

DBGET integrated database retrieval system