KEGG   Rhodococcus erythropolis PR4: RER_20470Help
Entry
RER_20470         CDS       T00881                                 

Gene name
pdp
Definition
pyrimidine nucleoside phosphorylase (EC:2.4.2.2)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RER_20470 (pdp)
Enzymes [BR:rer01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RER_20470 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2236254..2237549
Genome map
AA seq 431 aa AA seqDB search
MFDAVSIIGAKRDGRELSGTEIDWIVQAFTEGVVGDEQMSALAMAIYFRGMSRAETGRWT
EAMIESGGRMDFSDLPLPTVDKHSTGGVGDKITLPLAPLVAACGLAVPQLSGRGLGHTGG
TLDKLEAIPGWRAELTATEMVDILADPKIGAVICAAGANLAPADKKLYALRDVTGTVESI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKDLGDARELARTMVELGNDAGVRTSALIT
GMDTPLGLTAGNALEVRESVEVLAGGGPSDVVELTLVLAREMLSAAGIDGIDPADRLADG
TAMDRWRAMIAAQGGDPHATLPVARHSDVVTADRDGVLTRLDAMAVGIAAWKLGAGRERQ
GEAVQAGAGIEMHAKPGDVVRAGQKLMTLHTDTPERFDAARRSLGGGWSIGADSDTVSRP
LLIERIVGDSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacgcagtttccatcatcggcgccaagcgtgacggccgcgagttgtcgggaacc
gagatcgactggatagttcaggcgttcactgagggggtcgtcggcgacgagcagatgtcg
gcgctcgcgatggcgatctatttccgaggaatgtcacgagcagagaccggccgatggacc
gaggcaatgatcgaatccggcgggaggatggacttttcggacttgccgctgcccactgtc
gacaagcattcgaccggtggtgttggggacaagatcacccttccgctcgcgcccctcgtc
gcggcatgtggtcttgcagtcccgcagttgtcgggacgcggactcggccacaccggcgga
actctcgacaagctcgaggccattccaggttggcgagccgagctcacggcgacggagatg
gtcgacattctcgcggacccgaaaatcggcgcggtgatctgcgctgccggagcgaacctg
gcccccgccgacaagaagctctacgcgctgcgcgacgtgaccggaacggtggaatccatt
ccgctgatcgcaagttcgatcatgagcaagaagattgccgagggaaccggcgccctggtg
ctcgacgtcaaagtcggttccggagcgttcatgaaggacctcggcgacgcgcgagagttg
gcacgcacgatggtcgagttgggcaacgacgccggcgtgcgtacaagtgctctcatcacc
gggatggacaccccgctgggattgacggctggcaacgctctcgaggtgcgtgaatccgtc
gaggtgctggcaggcggcgggccgtccgacgtcgtcgagctgaccctggtcctggctcgg
gagatgctgtccgcggctgggatcgacggtatcgaccccgcagacagactggccgacggc
acggccatggaccggtggcgcgcgatgatcgccgcacaaggtggggacccacacgcgacg
ctgccggtggcccggcacagcgacgtcgtcaccgcggaccgagacggcgtgctgacccga
ctcgacgccatggcggtgggcatcgcggcctggaagctcggagccggacgcgaacgacag
ggcgaagccgttcaggccggtgccggcatcgagatgcacgcgaagcccggcgacgtggtc
cgcgccggacagaagctgatgacactgcacaccgacactcccgagagatttgatgctgcg
cggcggagcctcggcggaggctggtcgatcggggccgattccgacaccgtttcgcgaccg
ttgctcatcgagcgaattgtgggtgattcgcgttag

DBGET integrated database retrieval system