KEGG   Rhodococcus erythropolis PR4: RER_20930Help
Entry
RER_20930         CDS       T00881                                 

Gene name
bdhA
Definition
putative 3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RER_20930 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RER_20930 (bdhA)
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RER_20930 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2283055..2283798
Genome map
AA seq 247 aa AA seqDB search
MTLTGKSALVTGGASGIGEACARLLAARGAHVTVADLDDVAAKSLAEEIDGTAWAVDLLD
TDQLVDLSLETDILVNNAGIQRVSPIEDFDVEDFRKIQRLMVEAPFLLARAALPYMYRNS
FGRIVNISSVHGLRASAFKSAYVTAKHGLEGLSKVVALEGAPHGVTSNCVNPGYVLTPLV
RSQISDQAKVHGISESEVVEKVMLTESAIKRMVEPAEVASLVGWLASTEASMVTGASYTI
DGGWSAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaccggaaagtctgctctggtcaccggtggtgccagcgggatcggcgaggcg
tgtgctcgactcctcgccgcccgcggcgcgcacgtgaccgtcgccgatctcgacgacgtc
gccgcgaagtccctggccgaggagatcgacggcactgcgtgggccgtcgatctcctcgac
accgaccaactcgtggatctgtcactcgagacggacatactcgtcaacaacgccggcata
caacgggtcagtcctatcgaggatttcgacgtcgaggacttccggaagattcagcgcctc
atggtcgaagcgccattcctcctcgctcgggccgccctgccgtacatgtaccgcaacagt
ttcggtcgcatcgtgaacatttcctcggtccacgggctccgcgcttcggcattcaagagt
gcatacgtcacggctaagcacggactcgaaggactgtcgaaagttgttgcgctcgaaggc
gccccacacggtgtcaccagcaactgcgtcaatccgggctacgtcctgacgccactggtg
cgatcccagatctccgaccaggcaaaggttcacggaatcagtgaatccgaggttgtcgaa
aaggtgatgctcaccgagagcgcaatcaaacggatggtcgagcctgcggaggtggcatcg
ctggtgggctggttggcatcgaccgaggcgtcgatggtgacaggggcgtcgtacaccatc
gacggagggtggagcgccagctag

DBGET integrated database retrieval system