KEGG   Rhodococcus erythropolis PR4: RER_20930Help
Entry
RER_20930         CDS       T00881                                 

Gene name
bdhA
Definition
putative 3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rer00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rer00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2283055..2283798
Genome map
AA seq 247 aa AA seqDB search
MTLTGKSALVTGGASGIGEACARLLAARGAHVTVADLDDVAAKSLAEEIDGTAWAVDLLD
TDQLVDLSLETDILVNNAGIQRVSPIEDFDVEDFRKIQRLMVEAPFLLARAALPYMYRNS
FGRIVNISSVHGLRASAFKSAYVTAKHGLEGLSKVVALEGAPHGVTSNCVNPGYVLTPLV
RSQISDQAKVHGISESEVVEKVMLTESAIKRMVEPAEVASLVGWLASTEASMVTGASYTI
DGGWSAS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgaccggaaagtctgctctggtcaccggtggtgccagcgggatcggcgaggcg
tgtgctcgactcctcgccgcccgcggcgcgcacgtgaccgtcgccgatctcgacgacgtc
gccgcgaagtccctggccgaggagatcgacggcactgcgtgggccgtcgatctcctcgac
accgaccaactcgtggatctgtcactcgagacggacatactcgtcaacaacgccggcata
caacgggtcagtcctatcgaggatttcgacgtcgaggacttccggaagattcagcgcctc
atggtcgaagcgccattcctcctcgctcgggccgccctgccgtacatgtaccgcaacagt
ttcggtcgcatcgtgaacatttcctcggtccacgggctccgcgcttcggcattcaagagt
gcatacgtcacggctaagcacggactcgaaggactgtcgaaagttgttgcgctcgaaggc
gccccacacggtgtcaccagcaactgcgtcaatccgggctacgtcctgacgccactggtg
cgatcccagatctccgaccaggcaaaggttcacggaatcagtgaatccgaggttgtcgaa
aaggtgatgctcaccgagagcgcaatcaaacggatggtcgagcctgcggaggtggcatcg
ctggtgggctggttggcatcgaccgaggcgtcgatggtgacaggggcgtcgtacaccatc
gacggagggtggagcgccagctag

DBGET integrated database retrieval system