KEGG   Rhodococcus erythropolis PR4: RER_21140Help
Entry
RER_21140         CDS       T00881                                 

Definition
putative uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
rer  Rhodococcus erythropolis PR4
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rer00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RER_21140
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    RER_21140
Enzymes [BR:rer01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     RER_21140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2309447..2310424)
Genome map
AA seq 325 aa AA seqDB search
MTTENITTGNITTGVTSTDRLSGSIELTGHQYGKAENRVVRIYRDTPRHEIHDINVSTCL
RGDFADAYLTGDQSKVLPTDTQKQTAYSYAKEKGLISIETYGLELARHFVDDIEPVSGAR
IEIEEYAWERAIVDGSEHDYTWIRKGQEVRTASITVSDTGTADAGTWVIGGLKDLVILKS
TGSEFSGFLEDPYTILEPTDDRVMATTLVAQWRFVTTDVDWESVYVGIKAQIVKQFAQVH
SLALQQTLFHIGKAILEEFPIIAEVRLSAPNKHHFEYALGRFGVENDNEVFHAADRPYGL
IQAAVSRSDAPDAGPSWTPYSGWLS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccgaaaacatcacaaccggcaacatcacgaccggtgttacaagcaccgaccgg
ttgagcggatccatcgaacttaccggtcaccagtacggcaaagctgagaacagggtagtc
cgaatctaccgcgacactcctcgtcacgagatccacgacatcaacgtctccacttgcctg
cgtggagatttcgccgacgcgtacctcaccggcgatcagtcgaaggttctgccgaccgac
acgcagaaacaaacggcctattcctacgccaaggaaaagggtctgatctcgatcgagacg
tacggactcgaactcgcccgtcatttcgtcgacgacatcgaaccggtcagtggcgcgcgg
atcgagatcgaggaatacgcttgggagcgtgcaattgtcgacggcagcgagcacgactac
acctggattcggaagggtcaggaagttcggacggcgtcgatcacagtctccgatactggg
acagccgatgccgggacgtgggtgatcggcggcttgaaggacctggtgatcctcaaatcg
accggtagtgagttctcgggtttcctcgaagacccgtacacgatcctcgagccgacagac
gaccgcgtcatggcgacgacattggtcgcccagtggcgattcgtcaccaccgacgtcgac
tgggaatcggtctacgtgggtatcaaggcacaaatcgtcaaacagttcgcgcaggtgcat
tcacttgccttgcagcagacgctcttccacatcggcaaagcaattctcgaagagtttccg
atcattgccgaggttcgactgtcggcacccaacaagcatcatttcgaatatgcactcggc
cgcttcggagtcgagaacgacaacgaggtgttccacgccgccgatcgtccgtacgggctg
atccaagctgcggtcagccgatccgacgcaccagacgcggggccgtcgtggacaccctat
tcaggctggttgtcgtga

DBGET integrated database retrieval system